StarFunc result for job id Q13145

User Input

>input (260 residues)
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
SNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEA
SGQGNRYQHDGSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSND
KILSLVHWGMYSGHGKLEFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13145	1.000	1.000	3.155E-44	260	1.000	1.000	Q13145.pdb.gz	BAMBI_HUMAN BMP and activin membrane-bound inhibitor homolog OS=Homo sapiens OX=9606 GN=BAMBI PE=1 SV=1
2	AFDB:Q6IQW1	0.586	0.590	5.123E-31	258	0.746	0.752	Q6IQW1.pdb.gz
3	PDB:6wjcC	0.167	0.521	1.761E-1	69	0.054	0.203	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
4	PDB:2n99A	0.140	0.391	1.151	76	0.065	0.224	2n99A.pdb.gz
5	AFDB:Q8MYX1	0.138	0.099	1.324	389	0.127	0.085	Q8MYX1.pdb.gz	Q8MYX1_DROME RE60714p OS=Drosophila melanogaster OX=7227 GN=CG14636 PE=2 SV=1
6	AFDB:Q57UW8	0.197	0.069	1.608	1014	0.092	0.024	Q57UW8.pdb.gz	Q57UW8_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.540 PE=3 SV=1
7	PDB:7dvqR	0.130	0.141	2.198	241	0.085	0.091	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
8	PDB:2yboA	0.108	0.113	2.848	248	0.042	0.044	2yboA.pdb.gz	Crystal Structure of the Heme D1 Biosynthesis Enzyme Nire in Complex with its Substrate Reveals New Insights Into the Catalytic Mechanism of S-Adenosyl-L-Methionine-Dependent Uroporphyrinogen III Methyltransferases.
9	PDB:4v6wAV	0.097	0.216	2.848	82	0.038	0.122	4v6wAV.pdb.gz	Structures of the human and Drosophila 80S ribosome.
10	AFDB:Q9H0E7	0.158	0.071	2.879	712	0.119	0.044	Q9H0E7.pdb.gz	UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens OX=9606 GN=USP44 PE=1 SV=2
11	AFDB:Q6P5F6	0.159	0.053	3.072	833	0.088	0.028	Q6P5F6.pdb.gz	S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus OX=10090 GN=Slc39a10 PE=1 SV=1
12	PDB:5frtA	0.071	0.111	3.241	119	0.027	0.059	5frtA.pdb.gz	Structure of Fesi Protein from Azotobacter Vinelandii
13	AFDB:O14113	0.124	0.123	3.277	263	0.131	0.129	O14113.pdb.gz	SDE2_SCHPO Splicing regulator sde2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sde2 PE=1 SV=1
14	AFDB:G5EGQ9	0.117	0.036	4.529	1025	0.088	0.022	G5EGQ9.pdb.gz	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
15	AFDB:O62203	0.193	0.065	4.529	1073	0.131	0.032	O62203.pdb.gz	PHM2_CAEEL Pharyngeal muscle protein 2 OS=Caenorhabditis elegans OX=6239 GN=phm-2 PE=1 SV=3
16	PDB:7mpyB	0.097	0.066	4.779	430	0.023	0.014	7mpyB.pdb.gz
17	AFDB:Q586B9	0.238	0.163	4.832	420	0.119	0.074	Q586B9.pdb.gz	Q586B9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.355 PE=4 SV=1
18	PDB:2outA	0.092	0.144	5.099	131	0.050	0.099	2outA.pdb.gz
19	PDB:7ddeA	0.063	0.040	5.099	525	0.035	0.017	7ddeA.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
20	PDB:7zdzA	0.072	0.060	5.099	325	0.023	0.018	7zdzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13145	0.0	541	260	1.000	1.000	BAMBI_HUMAN BMP and activin membrane-bound inhibitor homolog OS=Homo sapiens OX=9606 GN=BAMBI PE=1 SV=1
2	Q91XN4	0.0	522	260	0.958	0.958	BAMBI_RAT BMP and activin membrane-bound inhibitor homolog OS=Rattus norvegicus OX=10116 GN=Bambi PE=2 SV=1
3	Q9DFZ0	1.89e-130	371	258	0.738	0.744	Q9DFZ0_DANRE BMP and activin membrane-bound inhibitor homolog OS=Danio rerio OX=7955 GN=bambi PE=2 SV=1
4	Q10051	0.013	38.9	492	0.127	0.067	PRP19_CAEEL Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans OX=6239 GN=prp-19 PE=3 SV=2
5	Q66HY1	0.67	33.5	534	0.112	0.054	Q66HY1_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=zgc:92227 PE=2 SV=1
6	Q9W629	1.2	32.7	530	0.123	0.060	Q9W629_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=bmpr1b PE=2 SV=1
7	F4K5P6	1.6	32.3	322	0.073	0.059	F4K5P6_ARATH Folate receptor family protein OS=Arabidopsis thaliana OX=3702 GN=At5g27830 PE=1 SV=1
8	P97881	2.0	32.3	547	0.058	0.027	MUC13_RAT Mucin-13 OS=Rattus norvegicus OX=10116 GN=Muc13 PE=2 SV=1
9	Q9SJ22	2.9	32.0	1088	0.081	0.019	CESA9_ARATH Probable cellulose synthase A catalytic subunit 9 [UDP-forming] OS=Arabidopsis thaliana OX=3702 GN=CESA9 PE=2 SV=1
10	P37088	3.1	31.6	669	0.062	0.024	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
11	Q8NER5	4.9	30.8	493	0.092	0.049	ACV1C_HUMAN Activin receptor type-1C OS=Homo sapiens OX=9606 GN=ACVR1C PE=1 SV=1
12	Q8GYA4	6.2	30.8	669	0.088	0.034	CRK10_ARATH Cysteine-rich receptor-like protein kinase 10 OS=Arabidopsis thaliana OX=3702 GN=CRK10 PE=1 SV=3
13	Q8K348	9.0	30.0	493	0.085	0.045	ACV1C_MOUSE Activin receptor type-1C OS=Mus musculus OX=10090 GN=Acvr1c PE=2 SV=3
14	F1P3H0	9.6	30.0	533	0.092	0.045	F1P3H0_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BMPR1A PE=3 SV=1
15	Q90754	9.8	30.0	533	0.092	0.045	Q90754_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	0.78	22.0	Activin types I and II receptor domain
2	PF06211 BAMBI	4.6e-61	215.1	BMP and activin membrane-bound inhibitor (BAMBI) N-terminal domain
3	PF19337 BAMBI_C	1.8e-81	282.1	BMP and activin membrane-bound inhibitor homolog C-terminus
4	PF06305 LapA_dom	1.6e+02	13.5	Lipopolysaccharide assembly protein A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364683

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262158	0.981	Mothers against decapentaplegic homolog 7
2	9606.ENSP00000363708	0.971	Bone morphogenetic protein receptor type-2
3	9606.ENSP00000401907	0.970	Bone morphogenetic protein receptor type-1B
4	9606.ENSP00000361107	0.965	Bone morphogenetic protein receptor type-1A
5	9606.ENSP00000364133	0.965	TGF-beta receptor type-1
6	9606.ENSP00000204604	0.961	Chordin
7	9606.ENSP00000256759	0.955	Follistatin
8	9606.ENSP00000245451	0.954	Bone morphogenetic protein 4
9	9606.ENSP00000478319	0.953	Gremlin-1
10	9606.ENSP00000328181	0.949	Noggin
11	9606.ENSP00000368104	0.946	Bone morphogenetic protein 2
12	9606.ENSP00000379204	0.944	Bone morphogenetic protein 7
13	9606.ENSP00000212355	0.938	Transforming growth factor beta receptor type 3
14	9606.ENSP00000283147	0.936	Bone morphogenetic protein 6
15	9606.ENSP00000351905	0.933	TGF-beta receptor type-2
16	9606.ENSP00000308219	0.930	RGM domain family member B
17	9606.ENSP00000238682	0.928	Transforming growth factor beta-3
18	9606.ENSP00000361112	0.928	Chordin-like protein 1
19	9606.ENSP00000452126	0.928	Repulsive guidance molecule A
20	9606.ENSP00000221930	0.926	Transforming growth factor beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005109	1.000	frizzled binding
GO:0005114	1.000	type II transforming growth factor beta receptor binding
GO:0098772	0.332	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0009966	0.995	regulation of signal transduction
GO:0090092	0.994	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090287	0.992	regulation of cellular response to growth factor stimulus
GO:0032501	0.985	multicellular organismal process
GO:0048856	0.977	anatomical structure development
GO:0048523	0.977	negative regulation of cellular process
GO:0090101	0.970	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007154	0.965	cell communication
GO:0007165	0.964	signal transduction
GO:0007166	0.954	cell surface receptor signaling pathway
GO:0048518	0.949	positive regulation of biological process
GO:0030510	0.946	regulation of BMP signaling pathway
GO:0007178	0.941	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050793	0.940	regulation of developmental process
GO:0030514	0.937	negative regulation of BMP signaling pathway
GO:0070848	0.935	response to growth factor
GO:0007275	0.908	multicellular organism development
GO:0019222	0.899	regulation of metabolic process
GO:0060255	0.892	regulation of macromolecule metabolic process
GO:0080090	0.889	regulation of primary metabolic process
GO:0031323	0.889	regulation of cellular metabolic process
GO:0051171	0.884	regulation of nitrogen compound metabolic process
GO:0009889	0.876	regulation of biosynthetic process
GO:0006355	0.873	regulation of DNA-templated transcription
GO:0048522	0.865	positive regulation of cellular process
GO:0010604	0.865	positive regulation of macromolecule metabolic process
GO:0051173	0.825	positive regulation of nitrogen compound metabolic process
GO:0031325	0.823	positive regulation of cellular metabolic process
GO:0071363	0.805	cellular response to growth factor stimulus
GO:0045595	0.798	regulation of cell differentiation
GO:0045935	0.778	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.777	positive regulation of biosynthetic process
GO:0010557	0.769	positive regulation of macromolecule biosynthetic process
GO:0031328	0.767	positive regulation of cellular biosynthetic process
GO:0045667	0.743	regulation of osteoblast differentiation
GO:0051239	0.741	regulation of multicellular organismal process
GO:0010717	0.736	regulation of epithelial to mesenchymal transition
GO:0009967	0.715	positive regulation of signal transduction
GO:0071559	0.714	response to transforming growth factor beta
GO:0045893	0.701	positive regulation of DNA-templated transcription
GO:0065009	0.693	regulation of molecular function
GO:0051094	0.679	positive regulation of developmental process
GO:0042127	0.667	regulation of cell population proliferation
GO:0051240	0.656	positive regulation of multicellular organismal process
GO:0045597	0.556	positive regulation of cell differentiation
GO:0045596	0.489	negative regulation of cell differentiation
GO:0044093	0.452	positive regulation of molecular function
GO:0008284	0.450	positive regulation of cell population proliferation
GO:0071560	0.416	cellular response to transforming growth factor beta stimulus
GO:0007179	0.398	transforming growth factor beta receptor signaling pathway
GO:0048731	0.337	system development
GO:0030154	0.330	cell differentiation
GO:2000026	0.305	regulation of multicellular organismal development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043226	0.540	organelle
GO:0043229	0.519	intracellular organelle
GO:0043231	0.489	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]