StarFunc result for job id Q13148

User Input

>input (414 residues)
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4E2	0.414	0.414	4.730E-68	414	1.000	1.000	A0A024R4E2.pdb.gz
2	AFDB:A0A2R8QEL5	0.284	0.291	1.151E-57	402	0.717	0.739	A0A2R8QEL5.pdb.gz
3	AFDB:A0A2R8Q8T5	0.305	0.304	1.508E-55	415	0.742	0.740	A0A2R8Q8T5.pdb.gz
4	AFDB:Q803N5	0.431	0.552	3.890E-48	303	0.568	0.776	Q803N5.pdb.gz	Q803N5_DANRE TAR DNA-binding protein 43 OS=Danio rerio OX=7955 GN=tardbpl PE=1 SV=1
5	AFDB:O97468	0.450	0.368	6.065E-40	531	0.466	0.363	O97468.pdb.gz	O97468_DROME TAR-binding protein OS=Drosophila melanogaster OX=7227 GN=TBPH PE=2 SV=1
6	AFDB:D0VWM8	0.331	0.331	3.808E-31	414	0.300	0.300	D0VWM8.pdb.gz	TADBP_CAEEL Tar DNA-binding protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=tdp-1 PE=1 SV=1
7	AFDB:Q91808	0.241	0.287	5.084E-19	340	0.196	0.238	Q91808.pdb.gz	Q91808_XENLA LOC397764 protein OS=Xenopus laevis OX=8355 GN=msi1.L PE=1 SV=1
8	AFDB:J4C3V8	0.200	0.234	1.146E-18	349	0.191	0.226	J4C3V8.pdb.gz
9	AFDB:Q9FM47	0.200	0.196	1.214E-18	423	0.237	0.232	Q9FM47.pdb.gz	Q9FM47_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=HLP1 PE=1 SV=1
10	AFDB:O43347	0.237	0.264	1.287E-18	362	0.196	0.224	O43347.pdb.gz	MSI1H_HUMAN RNA-binding protein Musashi homolog 1 OS=Homo sapiens OX=9606 GN=MSI1 PE=1 SV=1
11	PDB:7oqcF	0.178	0.270	9.739E-11	267	0.121	0.187	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	PDB:6y53o	0.174	0.433	8.840E-10	160	0.087	0.225	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:5lsbA	0.180	0.394	1.707E-8	176	0.070	0.165	5lsbA.pdb.gz
14	PDB:6y5qq	0.176	0.388	2.418E-8	178	0.085	0.197	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:6r5kH	0.180	0.188	6.873E-8	394	0.121	0.127	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
16	PDB:7evoD	0.168	0.339	7.284E-8	200	0.094	0.195	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:5vsuA	0.189	0.200	2.933E-7	387	0.097	0.103	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
18	PDB:6ff7X	0.159	0.362	3.921E-7	171	0.085	0.205	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:5xjcw	0.175	0.744	7.143E-6	91	0.043	0.198	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
20	PDB:5yzg1	0.172	0.288	1.136E-5	243	0.051	0.086	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GLU8	0.0	685	414	0.959	0.959	A0A8I6GLU8_RAT TAR DNA-binding protein 43 OS=Rattus norvegicus OX=10116 GN=Tardbp PE=4 SV=1
2	G3V162	0.0	595	298	0.676	0.940	G3V162_HUMAN TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1
3	Q13148	0.0	856	414	1.000	1.000	TADBP_HUMAN TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1
4	Q802C7	0.0	536	412	0.734	0.738	Q802C7_DANRE TAR DNA-binding protein 43 OS=Danio rerio OX=7955 GN=tardbp PE=1 SV=1
5	Q921F2	0.0	687	414	0.961	0.961	TADBP_MOUSE TAR DNA-binding protein 43 OS=Mus musculus OX=10090 GN=Tardbp PE=1 SV=1
6	Q803N5	1.95e-176	496	303	0.565	0.772	Q803N5_DANRE TAR DNA-binding protein 43 OS=Danio rerio OX=7955 GN=tardbpl PE=1 SV=1
7	Q9W1I0	2.27e-116	344	332	0.389	0.485	Q9W1I0_DROME TAR DNA-binding protein-43 homolog, isoform A OS=Drosophila melanogaster OX=7227 GN=TBPH PE=1 SV=2
8	O97469	5.91e-116	343	332	0.386	0.482	O97469_DROME TAR-binding protein OS=Drosophila melanogaster OX=7227 GN=TBPH PE=2 SV=1
9	Q8SXP8	8.64e-112	340	531	0.440	0.343	Q8SXP8_DROME GH09868p OS=Drosophila melanogaster OX=7227 GN=TBPH PE=1 SV=1
10	O97468	2.77e-111	338	531	0.437	0.341	O97468_DROME TAR-binding protein OS=Drosophila melanogaster OX=7227 GN=TBPH PE=2 SV=1
11	D0VWM8	3.53e-53	184	414	0.297	0.297	TADBP_CAEEL Tar DNA-binding protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=tdp-1 PE=1 SV=1
12	O94432	3.74e-26	112	474	0.191	0.167	YHKF_SCHPO Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC660.15 PE=4 SV=1
13	P48809	2.33e-25	108	421	0.188	0.185	RB27C_DROME Heterogeneous nuclear ribonucleoprotein 27C OS=Drosophila melanogaster OX=7227 GN=Hrb27C PE=1 SV=2
14	F4JFN7	7.27e-25	108	495	0.145	0.121	F4JFN7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07810 PE=1 SV=1
15	A4QP67	1.15e-24	105	314	0.135	0.178	A4QP67_DANRE Heterogeneous nuclear ribonucleoprotein D0 OS=Danio rerio OX=7955 GN=wu:fa28b06 PE=1 SV=1
16	F1Q8A5	1.17e-24	105	314	0.135	0.178	F1Q8A5_DANRE Heterogeneous nuclear ribonucleoprotein D OS=Danio rerio OX=7955 GN=wu:fa28b06 PE=1 SV=1
17	Q9QX80	1.26e-24	104	285	0.143	0.207	Q9QX80_RAT CArG-binding factor A OS=Rattus norvegicus OX=10116 GN=Hnrnpab PE=2 SV=1
18	F7F9P3	2.56e-24	104	311	0.143	0.190	F7F9P3_RAT Heterogeneous nuclear ribonucleoprotein A/B OS=Rattus norvegicus OX=10116 GN=Hnrnpab PE=1 SV=1
19	Q99020	3.16e-24	103	285	0.143	0.207	ROAA_MOUSE Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus OX=10090 GN=Hnrnpab PE=1 SV=1
20	D6R9P3	6.69e-24	102	280	0.135	0.200	D6R9P3_HUMAN Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11411 DNA_ligase_IV	5.3e+02	12.1	DNA ligase IV
2	PF15513 DUF4651	43	15.4	Domain of unknown function (DUF4651)
3	PF14605 Nup35_RRM_2	5.2e+02	12.1	Nup53/35/40-type RNA recognition motif
4	PF17797 RL	1.5	20.2	RL domain
5	PF00076 RRM_1	3e-25	99.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF08777 RRM_3	1.2	20.5	RNA binding motif
7	PF16367 RRM_7	1.8e-05	36.1	RNA recognition motif
8	PF18694 TDP43_N	1.5e-29	113.0	Transactive response DNA-binding protein N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354346	0.994	Matrin-3
2	9606.ENSP00000349168	0.988	Heterogeneous nuclear ribonucleoprotein H
3	9606.ENSP00000334061	0.987	Histone deacetylase 6
4	9606.ENSP00000341826	0.987	Heterogeneous nuclear ribonucleoprotein A1
5	9606.ENSP00000346694	0.987	Heterogeneous nuclear ribonucleoproteins A2/B1
6	9606.ENSP00000254108	0.985	RNA-binding protein FUS
7	9606.ENSP00000451291	0.984	Heterogeneous nuclear ribonucleoproteins C1/C2
8	9606.ENSP00000425979	0.983	Ribonuclease 3
9	9606.ENSP00000363745	0.980	Heterogeneous nuclear ribonucleoprotein R
10	9606.ENSP00000325376	0.974	Heterogeneous nuclear ribonucleoprotein M
11	9606.ENSP00000365439	0.972	Heterogeneous nuclear ribonucleoprotein K
12	9606.ENSP00000474096	0.970	TATA-binding protein-associated factor 2N
13	9606.ENSP00000258962	0.969	Serine/arginine-rich splicing factor 1
14	9606.ENSP00000349428	0.967	Polypyrimidine tract-binding protein 1
15	9606.ENSP00000385269	0.967	ELAV-like protein 1
16	9606.ENSP00000221419	0.958	Heterogeneous nuclear ribonucleoprotein L
17	9606.ENSP00000379475	0.958	Spliceosome RNA helicase DDX39B
18	9606.ENSP00000362820	0.950	Serine/arginine-rich splicing factor 3
19	9606.ENSP00000400433	0.949	Heterogeneous nuclear ribonucleoprotein F
20	9606.ENSP00000416959	0.948	Transformer-2 protein homolog beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.992	protein binding
GO:0003729	0.968	mRNA binding
GO:0003677	0.834	DNA binding
GO:0042802	0.557	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0044238	0.990	primary metabolic process
GO:0048518	0.989	positive regulation of biological process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0065008	0.984	regulation of biological quality
GO:0048522	0.979	positive regulation of cellular process
GO:0043170	0.974	macromolecule metabolic process
GO:0019222	0.946	regulation of metabolic process
GO:0031647	0.927	regulation of protein stability
GO:0034641	0.913	cellular nitrogen compound metabolic process
GO:1901360	0.911	organic cyclic compound metabolic process
GO:0006725	0.907	cellular aromatic compound metabolic process
GO:0071840	0.872	cellular component organization or biogenesis
GO:1903829	0.870	positive regulation of protein localization
GO:0046483	0.847	heterocycle metabolic process
GO:0010467	0.839	gene expression
GO:0060255	0.834	regulation of macromolecule metabolic process
GO:1904951	0.826	positive regulation of establishment of protein localization
GO:0051050	0.809	positive regulation of transport
GO:0006139	0.801	nucleobase-containing compound metabolic process
GO:0016043	0.795	cellular component organization
GO:0016070	0.786	RNA metabolic process
GO:0050896	0.770	response to stimulus
GO:0080090	0.766	regulation of primary metabolic process
GO:0051171	0.766	regulation of nitrogen compound metabolic process
GO:0051222	0.763	positive regulation of protein transport
GO:0006396	0.751	RNA processing
GO:0031323	0.728	regulation of cellular metabolic process
GO:0048519	0.678	negative regulation of biological process
GO:1900180	0.649	regulation of protein localization to nucleus
GO:0032386	0.647	regulation of intracellular transport
GO:0046822	0.623	regulation of nucleocytoplasmic transport
GO:0023051	0.616	regulation of signaling
GO:0010468	0.591	regulation of gene expression
GO:0051046	0.584	regulation of secretion
GO:0051716	0.569	cellular response to stimulus
GO:0010646	0.552	regulation of cell communication
GO:0009893	0.529	positive regulation of metabolic process
GO:0048523	0.526	negative regulation of cellular process
GO:0019219	0.522	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.496	positive regulation of macromolecule metabolic process
GO:0051252	0.458	regulation of RNA metabolic process
GO:0008380	0.392	RNA splicing
GO:0006950	0.372	response to stress
GO:0009892	0.331	negative regulation of metabolic process
GO:0010605	0.324	negative regulation of macromolecule metabolic process
GO:0031325	0.324	positive regulation of cellular metabolic process
GO:0009889	0.317	regulation of biosynthetic process
GO:0051173	0.312	positive regulation of nitrogen compound metabolic process
GO:0031326	0.312	regulation of cellular biosynthetic process
GO:0010556	0.310	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0043228	0.965	non-membrane-bounded organelle
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0005737	0.817	cytoplasm
GO:0016020	0.363	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]