StarFunc result for job id Q13151

User Input

>input (305 residues)
MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEE
ADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQ
FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIY
SGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGG
SSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGY
GGSSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13151	1.000	1.000	1.577E-56	305	1.000	1.000	Q13151.pdb.gz	ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1
2	AFDB:F1QS28	0.603	0.603	8.661E-37	305	0.590	0.590	F1QS28.pdb.gz	F1QS28_DANRE Heterogeneous nuclear ribonucleoprotein A0 OS=Danio rerio OX=7955 GN=fc01g05 PE=1 SV=1
3	AFDB:B5X0T7	0.599	0.608	1.246E-35	300	0.590	0.600	B5X0T7.pdb.gz	B5X0T7_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
4	AFDB:B5X3U2	0.606	0.660	8.211E-35	279	0.561	0.613	B5X3U2.pdb.gz	B5X3U2_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
5	AFDB:A7VJC2	0.567	0.492	2.203E-32	353	0.551	0.476	A7VJC2.pdb.gz	ROA2_RAT Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa2b1 PE=1 SV=1
6	AFDB:A0A024RB53	0.583	0.557	1.119E-31	320	0.521	0.497	A0A024RB53.pdb.gz	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	AFDB:Q6URK4	0.567	0.461	1.654E-31	379	0.580	0.467	Q6URK4.pdb.gz	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1
8	AFDB:A0A024RAZ7	0.579	0.477	4.680E-31	372	0.541	0.444	A0A024RAZ7.pdb.gz
9	AFDB:E7FAQ8	0.565	0.447	5.689E-31	388	0.574	0.451	E7FAQ8.pdb.gz
10	AFDB:F8VZ49	0.572	0.748	9.570E-31	231	0.387	0.511	F8VZ49.pdb.gz	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
11	PDB:6y53o	0.242	0.450	5.716E-12	160	0.131	0.250	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:7oqcF	0.244	0.277	9.617E-12	267	0.134	0.154	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:5vsuA	0.259	0.208	2.180E-10	387	0.118	0.093	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:5lsbA	0.239	0.405	6.586E-10	176	0.092	0.159	5lsbA.pdb.gz
15	PDB:6r5kH	0.243	0.192	3.347E-9	394	0.148	0.114	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
16	PDB:7evoD	0.261	0.391	8.317E-9	200	0.092	0.140	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:5yzg1	0.241	0.300	1.701E-8	243	0.111	0.140	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:6ff7X	0.228	0.393	3.960E-8	171	0.105	0.187	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:6y5qq	0.209	0.349	1.277E-7	178	0.079	0.135	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
20	PDB:7dvqY	0.257	0.533	2.610E-7	140	0.089	0.193	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13151	0.0	590	305	1.000	1.000	ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1
2	Q9CX86	5.72e-139	396	305	0.774	0.774	ROA0_MOUSE Heterogeneous nuclear ribonucleoprotein A0 OS=Mus musculus OX=10090 GN=Hnrnpa0 PE=1 SV=1
3	B5X3U2	1.32e-90	273	279	0.521	0.570	B5X3U2_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
4	Q6NYB0	9.43e-89	269	305	0.403	0.403	Q6NYB0_DANRE Zgc:77366 OS=Danio rerio OX=7955 GN=zgc:77366 PE=2 SV=1
5	F1QS28	1.22e-88	268	305	0.403	0.403	F1QS28_DANRE Heterogeneous nuclear ribonucleoprotein A0 OS=Danio rerio OX=7955 GN=fc01g05 PE=1 SV=1
6	F8W6I7	1.55e-81	250	307	0.492	0.489	F8W6I7_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=2
7	B5X3S8	2.64e-81	249	299	0.397	0.405	B5X3S8_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
8	B5X9N1	1.25e-80	246	261	0.403	0.471	B5X9N1_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
9	B5X0T7	2.93e-80	247	300	0.393	0.400	B5X0T7_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
10	A0A024RB53	2.38e-76	238	320	0.492	0.469	A0A024RB53_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
11	P49312	2.38e-76	238	320	0.492	0.469	ROA1_MOUSE Heterogeneous nuclear ribonucleoprotein A1 OS=Mus musculus OX=10090 GN=Hnrnpa1 PE=1 SV=2
12	Q0VAC0	2.38e-76	238	320	0.492	0.469	Q0VAC0_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRPA1 PE=2 SV=1
13	P04256	4.87e-76	237	320	0.492	0.469	ROA1_RAT Heterogeneous nuclear ribonucleoprotein A1 OS=Rattus norvegicus OX=10116 GN=Hnrnpa1 PE=1 SV=3
14	B4DDB6	1.55e-74	234	356	0.361	0.309	B4DDB6_HUMAN Heterogeneous nuclear ribonucleoprotein A3, isoform CRA_a OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
15	A0A384NL63	3.67e-74	234	378	0.361	0.291	A0A384NL63_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=HNRPA3 PE=2 SV=1
16	P51991	3.67e-74	234	378	0.361	0.291	ROA3_HUMAN Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2
17	Q6URK4	3.77e-74	234	379	0.361	0.290	ROA3_RAT Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus OX=10116 GN=Hnrnpa3 PE=1 SV=1
18	B5XFP5	6.00e-74	226	167	0.377	0.689	B5XFP5_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1
19	F8VZ49	3.82e-73	226	231	0.351	0.463	F8VZ49_HUMAN Heterogeneous nuclear ribonucleoprotein A1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=1
20	B5X9X4	7.08e-73	224	181	0.374	0.630	B5X9X4_SALSA Heterogeneous nuclear ribonucleoprotein A0 OS=Salmo salar OX=8030 GN=ROA0 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	2.4	19.5	Nup53/35/40-type RNA recognition motif
2	PF14703 PHM7_cyt	2.2e+02	13.5	Cytosolic domain of 10TM putative phosphate transporter
3	PF00076 RRM_1	1.3e-27	106.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	5.2e-05	34.6	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349168	0.997	Heterogeneous nuclear ribonucleoprotein H
2	9606.ENSP00000365439	0.997	Heterogeneous nuclear ribonucleoprotein K
3	9606.ENSP00000221419	0.996	Heterogeneous nuclear ribonucleoprotein L
4	9606.ENSP00000349428	0.994	Polypyrimidine tract-binding protein 1
5	9606.ENSP00000451291	0.994	Heterogeneous nuclear ribonucleoproteins C1/C2
6	9606.ENSP00000325376	0.993	Heterogeneous nuclear ribonucleoprotein M
7	9606.ENSP00000400433	0.993	Heterogeneous nuclear ribonucleoprotein F
8	9606.ENSP00000341826	0.992	Heterogeneous nuclear ribonucleoprotein A1
9	9606.ENSP00000258962	0.989	Serine/arginine-rich splicing factor 1
10	9606.ENSP00000346694	0.988	Heterogeneous nuclear ribonucleoproteins A2/B1
11	9606.ENSP00000361927	0.986	Heterogeneous nuclear ribonucleoprotein H2
12	9606.ENSP00000363745	0.986	Heterogeneous nuclear ribonucleoprotein R
13	9606.ENSP00000283179	0.984	Heterogeneous nuclear ribonucleoprotein U
14	9606.ENSP00000359645	0.982	RNA-binding motif protein, X chromosome
15	9606.ENSP00000354346	0.974	Matrin-3
16	9606.ENSP00000225792	0.965	Probable ATP-dependent RNA helicase DDX5
17	9606.ENSP00000305556	0.952	Poly(rC)-binding protein 1
18	9606.ENSP00000313199	0.952	Heterogeneous nuclear ribonucleoprotein D0
19	9606.ENSP00000385269	0.949	ELAV-like protein 1
20	9606.ENSP00000311747	0.943	RNA-binding protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0005515	0.994	protein binding
GO:0035925	0.862	mRNA 3'-UTR AU-rich region binding
GO:0019899	0.494	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0010468	0.988	regulation of gene expression
GO:0009987	0.985	cellular process
GO:0080090	0.981	regulation of primary metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:0044237	0.977	cellular metabolic process
GO:0044238	0.974	primary metabolic process
GO:0019219	0.966	regulation of nucleobase-containing compound metabolic process
GO:0009894	0.961	regulation of catabolic process
GO:0010608	0.958	post-transcriptional regulation of gene expression
GO:0051253	0.955	negative regulation of RNA metabolic process
GO:1903312	0.951	negative regulation of mRNA metabolic process
GO:0061013	0.933	regulation of mRNA catabolic process
GO:0043487	0.931	regulation of RNA stability
GO:0043489	0.922	RNA stabilization
GO:0006807	0.920	nitrogen compound metabolic process
GO:0043488	0.918	regulation of mRNA stability
GO:1902373	0.913	negative regulation of mRNA catabolic process
GO:0006397	0.912	mRNA processing
GO:0048255	0.904	mRNA stabilization
GO:0008380	0.483	RNA splicing
GO:0000375	0.392	RNA splicing, via transesterification reactions
GO:0000398	0.364	mRNA splicing, via spliceosome
GO:0048522	0.352	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.745	cytoplasm
GO:0032991	0.358	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]