StarFunc result for job id Q13163

User Input

>input (448 residues)
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNAAVVSMWVCRALEERRSQQGPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13163	1.000	1.000	5.754E-89	448	1.000	1.000	Q13163.pdb.gz	MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP2K5 PE=1 SV=2
2	AFDB:A9JRD0	0.852	0.848	7.004E-71	450	0.770	0.767	A9JRD0.pdb.gz	A9JRD0_DANRE Dual specificity mitogen-activated protein kinase kinase 5 OS=Danio rerio OX=7955 GN=zgc:172137 PE=2 SV=1
3	AFDB:G4NEB8	0.629	0.677	2.519E-34	415	0.333	0.359	G4NEB8.pdb.gz	MST7_MAGO7 Mitogen-activated protein kinase kinae MST7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MST7 PE=1 SV=1
4	AFDB:Q63932	0.592	0.660	1.754E-33	401	0.319	0.357	Q63932.pdb.gz	MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus OX=10090 GN=Map2k2 PE=1 SV=2
5	AFDB:A4QPA9	0.601	0.683	1.854E-33	393	0.310	0.354	A4QPA9.pdb.gz	A4QPA9_HUMAN Mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=2 SV=1
6	AFDB:Q24324	0.615	0.693	3.054E-33	396	0.301	0.341	Q24324.pdb.gz	DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster OX=7227 GN=Dsor1 PE=1 SV=2
7	PDB:3eqdA	0.628	0.882	4.251E-33	315	0.304	0.432	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
8	AFDB:Q10664	0.622	0.716	1.704E-32	387	0.306	0.354	Q10664.pdb.gz	MEK2_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-2 OS=Caenorhabditis elegans OX=6239 GN=mek-2 PE=1 SV=1
9	AFDB:Q5B7Q8	0.617	0.516	3.046E-31	539	0.286	0.237	Q5B7Q8.pdb.gz	Q5B7Q8_EMENI MAP kinase kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03422 PE=4 SV=1
10	AFDB:Q55CL6	0.587	0.402	8.264E-31	660	0.286	0.194	Q55CL6.pdb.gz	MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum OX=44689 GN=mekA PE=1 SV=1
11	AFDB:P10506	0.571	0.745	8.968E-30	340	0.288	0.379	P10506.pdb.gz	BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr1 PE=1 SV=1
12	PDB:5eymA	0.583	0.881	4.979E-27	292	0.281	0.432	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
13	PDB:8a8mB	0.508	0.740	3.634E-20	298	0.270	0.406	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
14	PDB:6s73A	0.509	0.825	2.524E-17	269	0.161	0.268	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
15	PDB:4eomC	0.469	0.734	4.909E-17	276	0.147	0.239	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:3c4wB	0.497	0.433	9.549E-17	519	0.170	0.146	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:4c0tA	0.473	0.701	1.488E-16	291	0.138	0.213	4c0tA.pdb.gz
18	PDB:4ek6A	0.459	0.723	2.075E-16	279	0.152	0.244	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
19	PDB:6pjxA	0.506	0.421	2.739E-16	543	0.150	0.123	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:4yc3A	0.464	0.681	4.768E-16	295	0.138	0.210	4yc3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9JRD0	0.0	674	450	0.770	0.767	A9JRD0_DANRE Dual specificity mitogen-activated protein kinase kinase 5 OS=Danio rerio OX=7955 GN=zgc:172137 PE=2 SV=1
2	B1NA67	0.0	689	449	0.772	0.771	B1NA67_DANRE Dual specificity mitogen-activated protein kinase kinase 5 isoform X1 OS=Danio rerio OX=7955 GN=wu:fb73f02 PE=2 SV=1
3	Q13163	0.0	932	448	1.000	1.000	MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP2K5 PE=1 SV=2
4	Q62862	0.0	917	448	0.982	0.982	MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus OX=10116 GN=Map2k5 PE=1 SV=1
5	Q9WVS7	0.0	912	448	0.978	0.978	MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus OX=10090 GN=Map2k5 PE=1 SV=1
6	A4QPA9	5.93e-86	270	393	0.315	0.359	A4QPA9_HUMAN Mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=2 SV=1
7	Q02750	5.93e-86	270	393	0.315	0.359	MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP2K1 PE=1 SV=2
8	Q63932	1.06e-85	270	401	0.310	0.347	MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus OX=10090 GN=Map2k2 PE=1 SV=2
9	Q01986	1.51e-85	269	393	0.304	0.346	MP2K1_RAT Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map2k1 PE=1 SV=2
10	P31938	2.11e-85	268	393	0.306	0.349	MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Map2k1 PE=1 SV=2
11	P29678	4.25e-85	268	393	0.306	0.349	MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus OX=9986 GN=MAP2K1 PE=1 SV=2
12	P36506	8.13e-85	267	400	0.308	0.345	MP2K2_RAT Dual specificity mitogen-activated protein kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map2k2 PE=1 SV=1
13	P36507	1.09e-82	262	400	0.310	0.347	MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1
14	Q24324	5.00e-81	257	396	0.286	0.323	DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster OX=7227 GN=Dsor1 PE=1 SV=2
15	Q10664	6.09e-81	257	387	0.290	0.336	MEK2_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-2 OS=Caenorhabditis elegans OX=6239 GN=mek-2 PE=1 SV=1
16	G4NEB8	1.74e-79	254	415	0.304	0.328	MST7_MAGO7 Mitogen-activated protein kinase kinae MST7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MST7 PE=1 SV=1
17	Q5B7Q8	2.95e-74	244	539	0.317	0.263	Q5B7Q8_EMENI MAP kinase kinase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03422 PE=4 SV=1
18	P10506	2.25e-72	233	340	0.270	0.356	BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr1 PE=1 SV=1
19	Q925D6	7.05e-72	231	334	0.315	0.422	Q925D6_RAT Mitogen-activated protein kinase kinase 6 OS=Rattus norvegicus OX=10116 GN=Map2k6 PE=1 SV=1
20	P70236	1.00e-71	231	334	0.315	0.422	MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus OX=10090 GN=Map2k6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.018	25.7	ABC1 atypical kinase-like domain
2	PF01636 APH	6.7e+02	11.5	Phosphotransferase enzyme family
3	PF14531 Kinase-like	1.9	19.3	Kinase-like
4	PF00564 PB1	4.6e-09	47.4	PB1 domain
5	PF00069 Pkinase	3.5e-60	215.2	Protein kinase domain
6	PF17667 Pkinase_fungal	0.055	23.9	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	4.4e-35	132.8	Protein tyrosine and serine/threonine kinase
8	PF07387 Seadorna_VP7	3.9e+02	11.5	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000009554

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000004148	0.996	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
2	60711.ENSCSAP00000000237	0.995	Mitogen-activated protein kinase kinase kinase 3
3	60711.ENSCSAP00000012883	0.995	Mitogen-activated protein kinase kinase kinase 2
4	60711.ENSCSAP00000012247	0.810	Mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
5	60711.ENSCSAP00000014131	0.751	Mitogen-activated protein kinase kinase kinase 8
6	60711.ENSCSAP00000006415	0.720	Mitogen-activated protein kinase 14
7	60711.ENSCSAP00000005294	0.719	Protein tyrosine phosphatase, receptor type, D
8	60711.ENSCSAP00000002490	0.715	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
9	60711.ENSCSAP00000006423	0.713	Mitogen-activated protein kinase 13
10	60711.ENSCSAP00000001253	0.711	Mitogen-activated protein kinase 11
11	60711.ENSCSAP00000001257	0.708	Mitogen-activated protein kinase 12
12	60711.ENSCSAP00000008475	0.699	Mitogen-activated protein kinase kinase kinase 4
13	60711.ENSCSAP00000009828	0.696	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
14	60711.ENSCSAP00000017867	0.692	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
15	60711.ENSCSAP00000015828	0.689	Neurotrophic tyrosine kinase, receptor, type 1
16	60711.ENSCSAP00000003844	0.686	Kinase suppressor of ras 1
17	60711.ENSCSAP00000004478	0.686	annotation not available
18	60711.ENSCSAP00000018826	0.674	During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS
19	60711.ENSCSAP00000017821	0.671	Nerve growth factor (beta polypeptide)
20	60711.ENSCSAP00000004594	0.667	Sequestosome 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.955	protein serine/threonine kinase activity
GO:0019899	0.538	enzyme binding
GO:0004708	0.511	MAP kinase kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0065007	0.995	biological regulation
GO:0050896	0.995	response to stimulus
GO:0050794	0.993	regulation of cellular process
GO:0051716	0.990	cellular response to stimulus
GO:0007165	0.978	signal transduction
GO:0035556	0.721	intracellular signal transduction
GO:0048518	0.706	positive regulation of biological process
GO:0008152	0.693	metabolic process
GO:0044237	0.675	cellular metabolic process
GO:0071704	0.651	organic substance metabolic process
GO:0048522	0.647	positive regulation of cellular process
GO:0044238	0.646	primary metabolic process
GO:0019222	0.645	regulation of metabolic process
GO:0060255	0.628	regulation of macromolecule metabolic process
GO:0006807	0.625	nitrogen compound metabolic process
GO:0043170	0.588	macromolecule metabolic process
GO:0031323	0.577	regulation of cellular metabolic process
GO:0019538	0.565	protein metabolic process
GO:0043412	0.559	macromolecule modification
GO:0080090	0.558	regulation of primary metabolic process
GO:0051171	0.547	regulation of nitrogen compound metabolic process
GO:0036211	0.543	protein modification process
GO:0000165	0.501	MAPK cascade
GO:0032502	0.499	developmental process
GO:0006793	0.494	phosphorus metabolic process
GO:0048856	0.489	anatomical structure development
GO:0032501	0.454	multicellular organismal process
GO:0048519	0.454	negative regulation of biological process
GO:0048583	0.431	regulation of response to stimulus
GO:0006796	0.430	phosphate-containing compound metabolic process
GO:0010646	0.426	regulation of cell communication
GO:0048523	0.421	negative regulation of cellular process
GO:0009966	0.416	regulation of signal transduction
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0010468	0.377	regulation of gene expression
GO:0051173	0.372	positive regulation of nitrogen compound metabolic process
GO:0051246	0.360	regulation of protein metabolic process
GO:0031325	0.359	positive regulation of cellular metabolic process
GO:0065009	0.341	regulation of molecular function
GO:0007275	0.307	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.998	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0005634	0.952	nucleus
GO:0016020	0.787	membrane
GO:0015630	0.429	microtubule cytoskeleton
GO:0070013	0.383	intracellular organelle lumen
GO:0031981	0.312	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.12.2	0.511	mitogen-activated protein kinase kinase.

[back to server]