StarFunc result for job id Q13164

User Input

>input (816 residues)
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZ20	0.634	0.634	0.000	816	1.000	1.000	A0A024QZ20.pdb.gz
2	AFDB:Q0H1F4	0.530	0.503	3.935E-74	862	0.555	0.526	Q0H1F4.pdb.gz	Q0H1F4_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=erk5 PE=1 SV=1
3	AFDB:E9QEY0	0.611	0.470	2.716E-71	1080	0.570	0.431	E9QEY0.pdb.gz	E9QEY0_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=bmk1 PE=1 SV=1
4	AFDB:Q5AAG6	0.395	0.625	3.011E-37	509	0.221	0.354	Q5AAG6.pdb.gz	MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MKC1 PE=1 SV=1
5	PDB:7opmA	0.396	0.873	8.232E-37	362	0.212	0.478	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
6	PDB:2zoqA	0.395	0.894	1.226E-35	352	0.213	0.494	2zoqA.pdb.gz	Crystal structure of human mono-phosphorylated ERK1 at Tyr204
7	PDB:2b9iA	0.389	0.918	4.734E-35	338	0.201	0.485	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
8	PDB:6dtlB	0.380	0.843	2.667E-34	357	0.212	0.485	6dtlB.pdb.gz
9	PDB:5bvdA	0.378	0.918	3.136E-34	330	0.201	0.497	5bvdA.pdb.gz	Tetrahydropyrrolo-diazepenones as inhibitors of ERK2 kinase.
10	PDB:3gc8A	0.372	0.850	6.462E-33	347	0.191	0.450	3gc8A.pdb.gz	The three-dimensional structure of MAP kinase p38beta: different features of the ATP-binding site in p38beta compared with p38alpha.
11	PDB:2ewaA	0.370	0.893	1.904E-32	330	0.183	0.452	2ewaA.pdb.gz	NMR characterization of kinase p38 dynamics in free and ligand-bound forms.
12	PDB:2lgcA	0.374	0.830	2.009E-32	359	0.196	0.446	2lgcA.pdb.gz
13	PDB:7cgaA	0.395	0.900	1.434E-30	347	0.163	0.383	7cgaA.pdb.gz
14	AFDB:C8VFS8	0.318	0.765	1.416E-29	330	0.178	0.439	C8VFS8.pdb.gz	C8VFS8_EMENI mitogen-activated protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05666 PE=4 SV=1
15	AFDB:Q9W354	0.411	0.369	3.016E-29	916	0.196	0.175	Q9W354.pdb.gz	ERK7_DROME Extracellular signal-regulated kinase 7 OS=Drosophila melanogaster OX=7227 GN=Erk7 PE=1 SV=2
16	PDB:3coiA	0.360	0.821	4.086E-29	344	0.174	0.413	3coiA.pdb.gz
17	AFDB:Q23356	0.284	0.215	7.322E-20	1096	0.174	0.130	Q23356.pdb.gz	MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans OX=6239 GN=mig-15 PE=2 SV=3
18	AFDB:Q0WPH8	0.289	0.248	8.158E-20	956	0.164	0.140	Q0WPH8.pdb.gz	NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana OX=3702 GN=NEK5 PE=1 SV=1
19	AFDB:Q55FT4	0.283	0.107	2.983E-19	2247	0.161	0.058	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
20	AFDB:Q9VP22	0.337	0.241	1.283E-18	1157	0.147	0.104	Q9VP22.pdb.gz	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QEY0	0.0	603	1080	0.344	0.260	E9QEY0_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=bmk1 PE=1 SV=1
2	P0C865	0.0	1276	806	0.912	0.923	MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus OX=10116 GN=Mapk7 PE=1 SV=1
3	Q0H1F4	0.0	751	862	0.561	0.531	Q0H1F4_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=erk5 PE=1 SV=1
4	Q13164	0.0	1642	816	1.000	1.000	MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens OX=9606 GN=MAPK7 PE=1 SV=2
5	Q9WVS8	0.0	1271	806	0.908	0.919	MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus OX=10090 GN=Mapk7 PE=1 SV=1
6	P42525	3.19e-123	382	529	0.219	0.338	ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum OX=44689 GN=erkA PE=2 SV=2
7	Q39024	1.78e-121	372	376	0.225	0.489	MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana OX=3702 GN=MPK4 PE=1 SV=2
8	A9T142	3.04e-121	372	375	0.218	0.475	MPK4A_PHYPA Mitogen-activated protein kinase 4a OS=Physcomitrium patens OX=3218 GN=MPK4a PE=1 SV=1
9	A9S9Q8	4.42e-119	366	380	0.223	0.479	MPK4B_PHYPA Mitogen-activated protein kinase 4b OS=Physcomitrium patens OX=3218 GN=MPK4b PE=1 SV=1
10	C8V7D1	1.12e-115	357	354	0.224	0.517	C8V7D1_EMENI Mitogen-activated protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mpkB PE=1 SV=1
11	Q39023	1.25e-115	357	370	0.221	0.486	MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MPK3 PE=1 SV=2
12	G9CU32	2.46e-115	357	397	0.223	0.458	G9CU32_GOSHI Mitogen-activated protein kinase OS=Gossypium hirsutum OX=3635 GN=MPK6 PE=2 SV=1
13	Q9LMM5	5.86e-115	355	369	0.217	0.480	MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=MPK11 PE=1 SV=1
14	P27361	1.27e-114	355	379	0.213	0.459	MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4
15	Q9LQQ9	4.57e-114	353	363	0.212	0.477	MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana OX=3702 GN=MPK13 PE=1 SV=1
16	Q7ZVK8	4.81e-114	354	392	0.217	0.452	Q7ZVK8_DANRE Mitogen-activated protein kinase OS=Danio rerio OX=7955 GN=wu:fi06b09 PE=1 SV=1
17	P21708	5.82e-114	353	380	0.214	0.461	MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus OX=10116 GN=Mapk3 PE=1 SV=5
18	Q63844	7.69e-114	353	380	0.214	0.461	MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus OX=10090 GN=Mapk3 PE=1 SV=5
19	A5WYZ9	3.73e-113	351	372	0.214	0.470	A5WYZ9_GOSHI Mitogen-activated protein kinase OS=Gossypium hirsutum OX=3635 GN=MAPK PE=2 SV=1
20	Q39026	4.02e-113	352	395	0.224	0.463	MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana OX=3702 GN=MPK6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	25	15.4	ABC1 atypical kinase-like domain
2	PF01636 APH	2.3e+02	13.0	Phosphotransferase enzyme family
3	PF06293 Kdo	1.8	19.5	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	1.3e+02	13.4	Kinase-like
5	PF00069 Pkinase	2.8e-63	225.4	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	4.9e-29	113.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311005

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000178640	0.997	Dual specificity mitogen-activated protein kinase kinase 5
2	9606.ENSP00000340874	0.991	Myocyte-specific enhancer factor 2C
3	9606.ENSP00000346389	0.988	Myocyte-specific enhancer factor 2A
4	9606.ENSP00000271555	0.986	Myocyte-specific enhancer factor 2D
5	9606.ENSP00000279488	0.968	Dual specificity protein phosphatase 6
6	9606.ENSP00000395708	0.954	Rap guanine nucleotide exchange factor 3
7	9606.ENSP00000417183	0.950	Dual specificity protein phosphatase 7
8	9606.ENSP00000468348	0.944	Dual specificity mitogen-activated protein kinase kinase 6
9	9606.ENSP00000240100	0.942	Dual specificity protein phosphatase 4
10	9606.ENSP00000435412	0.940	Ribosomal protein S6 kinase alpha-1
11	9606.ENSP00000282561	0.937	Gap junction alpha-1 protein
12	9606.ENSP00000226004	0.934	Dual specificity protein phosphatase 3
13	9606.ENSP00000368884	0.933	Ribosomal protein S6 kinase alpha-3
14	9606.ENSP00000427015	0.933	Ribosomal protein S6 kinase alpha-2
15	9606.ENSP00000250003	0.931	Myoblast determination protein 1
16	9606.ENSP00000418447	0.925	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
17	9606.ENSP00000221138	0.917	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
18	9606.ENSP00000367830	0.915	Protein kinase C zeta type
19	9606.ENSP00000469880	0.912	Inactive serine/threonine-protein kinase VRK3
20	9606.ENSP00000417963	0.911	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004707	0.994	MAP kinase activity
GO:0019899	0.680	enzyme binding
GO:0097159	0.390	organic cyclic compound binding
GO:1901363	0.387	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.998	cellular response to stimulus
GO:0007154	0.997	cell communication
GO:0023052	0.989	signaling
GO:0007165	0.978	signal transduction
GO:0080090	0.859	regulation of primary metabolic process
GO:0051171	0.859	regulation of nitrogen compound metabolic process
GO:0048518	0.858	positive regulation of biological process
GO:0008152	0.849	metabolic process
GO:0060255	0.848	regulation of macromolecule metabolic process
GO:0071704	0.839	organic substance metabolic process
GO:0006807	0.826	nitrogen compound metabolic process
GO:0044238	0.816	primary metabolic process
GO:0035556	0.812	intracellular signal transduction
GO:0043170	0.784	macromolecule metabolic process
GO:0048522	0.784	positive regulation of cellular process
GO:0031323	0.784	regulation of cellular metabolic process
GO:0044237	0.762	cellular metabolic process
GO:0048519	0.705	negative regulation of biological process
GO:0009893	0.695	positive regulation of metabolic process
GO:0048523	0.688	negative regulation of cellular process
GO:1901564	0.629	organonitrogen compound metabolic process
GO:0036211	0.616	protein modification process
GO:0010604	0.602	positive regulation of macromolecule metabolic process
GO:0048583	0.544	regulation of response to stimulus
GO:0051173	0.514	positive regulation of nitrogen compound metabolic process
GO:0006796	0.490	phosphate-containing compound metabolic process
GO:0031325	0.487	positive regulation of cellular metabolic process
GO:0023051	0.486	regulation of signaling
GO:0010646	0.484	regulation of cell communication
GO:0010468	0.480	regulation of gene expression
GO:0009966	0.469	regulation of signal transduction
GO:0051252	0.468	regulation of RNA metabolic process
GO:0010556	0.465	regulation of macromolecule biosynthetic process
GO:0006355	0.457	regulation of DNA-templated transcription
GO:0042221	0.449	response to chemical
GO:0045935	0.447	positive regulation of nucleobase-containing compound metabolic process
GO:0051246	0.389	regulation of protein metabolic process
GO:0006950	0.357	response to stress
GO:1902531	0.331	regulation of intracellular signal transduction
GO:0031328	0.329	positive regulation of cellular biosynthetic process
GO:0070887	0.325	cellular response to chemical stimulus
GO:0010557	0.325	positive regulation of macromolecule biosynthetic process
GO:0051254	0.314	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.963	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.24	0.994	mitogen-activated protein kinase.

[back to server]