StarFunc result for job id Q13185

User Input

>input (183 residues)
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNT
WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG
LDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED
EAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23198	0.975	0.975	1.146E-32	183	0.995	0.995	P23198.pdb.gz	CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2
2	AFDB:O93480	0.488	0.485	1.980E-22	185	0.683	0.676	O93480.pdb.gz	O93480_CHICK Chromobox protein (CHCB1) OS=Gallus gallus OX=9031 PE=2 SV=1
3	AFDB:P45973	0.382	0.366	4.554E-21	191	0.623	0.597	P45973.pdb.gz	CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1
4	AFDB:Q95SE0	0.445	0.367	2.105E-16	240	0.443	0.338	Q95SE0.pdb.gz	Q95SE0_DROME GM01918p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
5	AFDB:P05205	0.351	0.313	8.482E-16	206	0.481	0.427	P05205.pdb.gz	HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)205 PE=1 SV=2
6	AFDB:Q9VCU6	0.354	0.276	1.325E-13	237	0.339	0.262	Q9VCU6.pdb.gz	Q9VCU6_DROME Heterochromatin protein 1c OS=Drosophila melanogaster OX=7227 GN=HP1c PE=1 SV=1
7	AFDB:G5EDE2	0.480	0.499	1.276E-12	175	0.333	0.349	G5EDE2.pdb.gz	CBXH2_CAEEL Chromobox protein homolog hpl-2 OS=Caenorhabditis elegans OX=6239 GN=hpl-2 PE=1 SV=1
8	AFDB:G5EET5	0.320	0.319	1.031E-11	184	0.295	0.293	G5EET5.pdb.gz	CBXH1_CAEEL Chromobox protein homolog hpl-1 OS=Caenorhabditis elegans OX=6239 GN=hpl-1 PE=1 SV=1
9	AFDB:Q54RN0	0.347	0.285	9.928E-11	225	0.339	0.276	Q54RN0.pdb.gz	Q54RN0_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hcpA PE=4 SV=1
10	AFDB:Q54RQ4	0.354	0.269	1.880E-10	244	0.328	0.246	Q54RQ4.pdb.gz	Q54RQ4_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=hcpB PE=4 SV=1
11	PDB:6g0lW	0.282	0.081	1.375E-4	878	0.180	0.038	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
12	PDB:6g0lM	0.277	0.079	7.846E-4	855	0.164	0.035	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:2iw3B	0.250	0.052	7.269E-2	980	0.066	0.012	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
14	PDB:3o4fC	0.178	0.120	7.415E-1	284	0.027	0.018	3o4fC.pdb.gz
15	PDB:7f5sLT	0.160	0.179	7.415E-1	159	0.104	0.119	7f5sLT.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
16	PDB:7zpkC	0.141	0.117	8.825E-1	233	0.087	0.069	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
17	PDB:3anxB	0.177	0.110	1.050	313	0.033	0.019	3anxB.pdb.gz	Crystal structures and enzymatic properties of a triamine/agmatine aminopropyltransferase from Thermus thermophilus
18	PDB:7nkyQ	0.117	0.064	1.050	404	0.087	0.040	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
19	PDB:6o65B	0.145	0.093	1.113	294	0.033	0.020	6o65B.pdb.gz	Spermidine Synthase (SPDS) Undergoes Concerted Structural Rearrangements Upon Ligand Binding - A Case Study of the Two SPDS Isoforms FromArabidopsis thaliana.
20	PDB:1ak5A	0.130	0.076	1.250	329	0.060	0.033	1ak5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13185	7.90e-134	373	183	1.000	1.000	CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4
2	Q5RJK5	7.90e-134	373	183	1.000	1.000	Q5RJK5_RAT Chromobox 3 OS=Rattus norvegicus OX=10116 GN=Cbx3 PE=1 SV=1
3	P23198	1.20e-132	370	183	0.995	0.995	CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus OX=10090 GN=Cbx3 PE=1 SV=2
4	Q61686	1.78e-74	223	191	0.628	0.602	CBX5_MOUSE Chromobox protein homolog 5 OS=Mus musculus OX=10090 GN=Cbx5 PE=1 SV=1
5	P45973	5.43e-74	222	191	0.628	0.602	CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1
6	V9HWG0	5.43e-74	222	191	0.628	0.602	V9HWG0_HUMAN Epididymis luminal protein 25 OS=Homo sapiens OX=9606 GN=HEL25 PE=1 SV=1
7	P83916	5.16e-69	209	185	0.672	0.665	CBX1_HUMAN Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1
8	P83917	5.16e-69	209	185	0.672	0.665	CBX1_MOUSE Chromobox protein homolog 1 OS=Mus musculus OX=10090 GN=Cbx1 PE=1 SV=1
9	O93480	3.34e-68	207	185	0.656	0.649	O93480_CHICK Chromobox protein (CHCB1) OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q9W396	3.60e-53	171	240	0.475	0.362	Q9W396_DROME FI06908p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
11	Q95SE0	4.10e-53	171	240	0.475	0.362	Q95SE0_DROME GM01918p OS=Drosophila melanogaster OX=7227 GN=HP1b PE=1 SV=1
12	P05205	1.46e-41	140	206	0.481	0.427	HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster OX=7227 GN=Su(var)205 PE=1 SV=2
13	Q9VCU6	2.82e-33	120	237	0.333	0.257	Q9VCU6_DROME Heterochromatin protein 1c OS=Drosophila melanogaster OX=7227 GN=HP1c PE=1 SV=1
14	Q5RJL1	1.25e-32	113	71	0.301	0.775	Q5RJL1_RAT Cbx3 protein OS=Rattus norvegicus OX=10116 GN=Cbx3 PE=2 SV=1
15	G5EET5	1.96e-25	98.6	184	0.306	0.304	CBXH1_CAEEL Chromobox protein homolog hpl-1 OS=Caenorhabditis elegans OX=6239 GN=hpl-1 PE=1 SV=1
16	G5EDE2	2.16e-23	93.2	175	0.339	0.354	CBXH2_CAEEL Chromobox protein homolog hpl-2 OS=Caenorhabditis elegans OX=6239 GN=hpl-2 PE=1 SV=1
17	Q9VHG0	1.09e-22	91.3	174	0.273	0.287	Q9VHG0_DROME Heterochromatin protein 1e OS=Drosophila melanogaster OX=7227 GN=HP1e PE=2 SV=2
18	Q9VR09	1.97e-18	78.2	106	0.186	0.321	Q9VR09_DROME Heterochromatin protein 6 OS=Drosophila melanogaster OX=7227 GN=HP6 PE=1 SV=1
19	Q05BI5	2.39e-11	62.8	258	0.164	0.116	Q05BI5_MOUSE Cbx4 protein (Fragment) OS=Mus musculus OX=10090 GN=Cbx4 PE=2 SV=1
20	A0A0S2Z5B2	6.45e-11	62.4	560	0.164	0.054	A0A0S2Z5B2_HUMAN Chromobox homolog 4 (Pc class homolog, Drosophila), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=CBX4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	1.4e-16	71.4	Chromo (CHRromatin Organisation MOdifier) domain
2	PF01393 Chromo_shadow	1.5e-26	103.6	Chromo shadow domain
3	PF14061 Mtf2_C	14	17.3	Polycomb-like MTF2 factor 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008839715.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008819721.1	0.984	Histone-lysine N-methyltransferase EHMT2 isoform X1
2	1026970.XP_008830094.1	0.955	Histone H1.4
3	1026970.XP_008821046.1	0.925	Tripartite motif containing 28
4	1026970.XP_008824872.1	0.915	Uncharacterized protein LOC103728687
5	1026970.XP_008848323.1	0.901	Transcription factor E2F6 isoform X1
6	1026970.XP_008829454.1	0.900	Histone-lysine N-methyltransferase EHMT1
7	1026970.XP_008840767.1	0.892	Suppressor of variegation 3-9 homolog 1
8	1026970.XP_008843900.1	0.890	Polycomb group ring finger 6
9	1026970.XP_008843033.1	0.850	L3MBTL2 polycomb repressive complex 1 subunit
10	1026970.XP_008849209.1	0.803	L(3)mbt-like 1 (Drosophila)
11	1026970.XP_008830078.1	0.783	Histone H1.3
12	1026970.XP_008835470.1	0.761	Chromatin assembly factor 1 subunit A
13	1026970.XP_008853744.1	0.759	BRCA1, DNA repair associated
14	1026970.XP_008830079.1	0.755	Uncharacterized protein LOC103733091
15	1026970.XP_008830084.1	0.755	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
16	1026970.XP_008841936.1	0.755	Histone H3-like
17	1026970.XP_008846795.1	0.740	Lysine-specific histone demethylase 1A
18	1026970.XP_008837276.1	0.735	Chromobox 5
19	1026970.XP_008838033.1	0.731	TERF1 interacting nuclear factor 2
20	1026970.XP_008822501.1	0.730	E3 ubiquitin-protein ligase RING2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:0003676	0.990	nucleic acid binding
GO:0003677	0.981	DNA binding
GO:0043565	0.912	sequence-specific DNA binding
GO:0140297	0.867	DNA-binding transcription factor binding
GO:0003690	0.829	double-stranded DNA binding
GO:0001067	0.823	transcription regulatory region nucleic acid binding
GO:1990837	0.813	sequence-specific double-stranded DNA binding
GO:0000976	0.799	transcription cis-regulatory region binding
GO:0003682	0.768	chromatin binding
GO:0042393	0.434	histone binding
GO:0042802	0.406	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0009987	0.985	cellular process
GO:0010468	0.984	regulation of gene expression
GO:0019219	0.973	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.971	negative regulation of biological process
GO:0048523	0.960	negative regulation of cellular process
GO:0010605	0.930	negative regulation of macromolecule metabolic process
GO:0006355	0.916	regulation of DNA-templated transcription
GO:0010558	0.904	negative regulation of macromolecule biosynthetic process
GO:0031327	0.903	negative regulation of cellular biosynthetic process
GO:0051253	0.901	negative regulation of RNA metabolic process
GO:0045892	0.883	negative regulation of DNA-templated transcription
GO:0050896	0.600	response to stimulus
GO:0051716	0.591	cellular response to stimulus
GO:0071840	0.467	cellular component organization or biogenesis
GO:0016043	0.433	cellular component organization
GO:0006325	0.376	chromatin organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0000785	1.000	chromatin
GO:0000792	0.992	heterochromatin
GO:0005654	0.991	nucleoplasm
GO:0032991	0.911	protein-containing complex
GO:0098687	0.718	chromosomal region
GO:0000775	0.712	chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]