StarFunc result for job id Q13188

User Input

>input (491 residues)
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JI10	0.843	0.833	7.640E-75	497	0.969	0.958	Q9JI10.pdb.gz	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
2	AFDB:Q7ZUQ3	0.964	0.962	8.511E-75	492	0.894	0.892	Q7ZUQ3.pdb.gz	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
3	AFDB:D4A648	0.931	0.939	5.693E-67	487	0.760	0.766	D4A648.pdb.gz	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
4	AFDB:Q8T0S6	0.647	0.477	2.287E-51	669	0.593	0.435	Q8T0S6.pdb.gz	HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster OX=7227 GN=hpo PE=1 SV=1
5	AFDB:Q9NB31	0.698	0.689	1.054E-49	497	0.532	0.525	Q9NB31.pdb.gz	CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans OX=6239 GN=cst-1 PE=1 SV=1
6	AFDB:F5H5B4	0.684	0.773	2.014E-49	432	0.660	0.750	F5H5B4.pdb.gz	F5H5B4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=1
7	AFDB:O61125	0.546	0.581	1.347E-41	461	0.436	0.464	O61125.pdb.gz	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
8	AFDB:F8W562	0.549	0.639	4.558E-36	421	0.340	0.397	F8W562.pdb.gz	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
9	AFDB:A0A0R4IN78	0.556	0.630	2.427E-35	432	0.371	0.421	A0A0R4IN78.pdb.gz	A0A0R4IN78_DANRE Serine/threonine kinase 24b (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk24 PE=1 SV=1
10	AFDB:Q7ZVG8	0.547	0.632	4.393E-35	424	0.348	0.403	Q7ZVG8.pdb.gz	Q7ZVG8_DANRE Serine/threonine kinase 25 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk25 PE=2 SV=1
11	PDB:3eqdA	0.488	0.740	6.556E-23	315	0.222	0.346	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:5eymA	0.442	0.715	1.392E-19	292	0.210	0.353	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
13	PDB:4eomC	0.444	0.760	1.271E-18	276	0.147	0.261	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
14	PDB:5u6yA	0.443	0.472	4.898E-18	459	0.171	0.183	5u6yA.pdb.gz
15	PDB:2yaaA	0.460	0.728	8.865E-18	300	0.161	0.263	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
16	PDB:8bfsA	0.409	0.685	3.066E-17	274	0.141	0.252	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
17	PDB:8a8mB	0.459	0.726	4.473E-17	298	0.196	0.322	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
18	PDB:4gcjA	0.430	0.670	5.858E-17	304	0.161	0.260	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
19	PDB:1unlA	0.444	0.726	6.182E-17	292	0.151	0.253	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
20	PDB:4ek6A	0.426	0.715	6.887E-17	279	0.157	0.276	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A648	0.0	754	488	0.762	0.766	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
2	F5H5B4	0.0	536	432	0.603	0.685	F5H5B4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=1
3	Q13043	0.0	763	487	0.774	0.780	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
4	Q13188	0.0	1025	491	1.000	1.000	STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2
5	Q7ZUQ3	0.0	853	492	0.874	0.872	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
6	Q9JI10	0.0	988	497	0.969	0.958	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
7	Q9JI11	0.0	761	487	0.772	0.778	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
8	Q9NB31	5.31e-178	510	497	0.554	0.547	CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans OX=6239 GN=cst-1 PE=1 SV=1
9	Q8T0S6	9.99e-171	498	669	0.527	0.387	HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster OX=7227 GN=hpo PE=1 SV=1
10	O61125	5.65e-134	397	461	0.466	0.497	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
11	Q55FS2	5.47e-105	339	1105	0.316	0.140	STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum OX=44689 GN=krsB PE=3 SV=1
12	Q9VEN3	1.29e-101	320	642	0.318	0.243	Q9VEN3_DROME FI20177p1 OS=Drosophila melanogaster OX=7227 GN=GckIII PE=1 SV=1
13	Q8IGS1	1.53e-101	319	642	0.318	0.243	Q8IGS1_DROME RE38276p OS=Drosophila melanogaster OX=7227 GN=GckIII PE=2 SV=1
14	O61122	1.71e-101	314	478	0.301	0.310	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
15	Q499L9	8.82e-101	310	416	0.320	0.377	Q499L9_HUMAN Serine/threonine protein kinase MST4 OS=Homo sapiens OX=9606 GN=MST4 PE=1 SV=1
16	F8W562	1.20e-100	310	421	0.322	0.375	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
17	F1LXV3	1.40e-100	309	392	0.320	0.401	F1LXV3_RAT Protein kinase domain-containing protein OS=Rattus norvegicus OX=10116 GN=Stk26 PE=1 SV=3
18	Q9P289	1.67e-100	310	416	0.320	0.377	STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26 PE=1 SV=2
19	H2L099	2.64e-100	317	653	0.301	0.227	GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans OX=6239 GN=gck-1 PE=1 SV=1
20	Q5U0E6	3.05e-99	307	431	0.320	0.364	Q5U0E6_HUMAN Epididymis secretory protein Li 95 OS=Homo sapiens OX=9606 GN=HEL-S-95 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.8e-08	43.7	ABC1 atypical kinase-like domain
2	PF07751 Abi_2	2.3e+02	13.5	Abi-like protein
3	PF09603 Fib_succ_major	1.7e+02	14.2	Fibrobacter succinogenes major domain (Fib_succ_major)
4	PF11629 Mst1_SARAH	2.8e-22	89.7	C terminal SARAH domain of Mst1
5	PF00069 Pkinase	1.1e-67	239.7	Protein kinase domain
6	PF17667 Pkinase_fungal	0.0073	26.7	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	1.3e-48	177.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000021064

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000006597	0.995	Salvador family WW domain containing protein 1
2	9601.ENSPPYP00000013698	0.995	MOB kinase activator 1A
3	9601.ENSPPYP00000015490	0.986	Ras association (RalGDS/AF-6) domain family member 1
4	9601.ENSPPYP00000019136	0.977	Large tumor suppressor kinase 1
5	9601.ENSPPYP00000012063	0.975	Ras association (RalGDS/AF-6) domain family member 2
6	9601.ENSPPYP00000016542	0.975	MOB kinase activator 1B
7	9601.ENSPPYP00000005920	0.972	Large tumor suppressor kinase 2
8	9601.ENSPPYP00000012335	0.950	Serine/threonine kinase 4
9	9601.ENSPPYP00000002598	0.948	Uncharacterized protein
10	9601.ENSPPYP00000017020	0.932	Caspase 3, apoptosis-related cysteine peptidase
11	9601.ENSPPYP00000020727	0.908	Protein phosphatase 2, catalytic subunit, beta isozyme
12	9601.ENSPPYP00000004354	0.892	Yes-associated protein 1
13	9601.ENSPPYP00000000306	0.865	Ras association (RalGDS/AF-6) domain family member 5
14	9601.ENSPPYP00000011577	0.832	Pongo abelii protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), mRNA
15	9601.ENSPPYP00000007053	0.820	Uncharacterized protein
16	9601.ENSPPYP00000012998	0.820	Uncharacterized protein
17	9601.ENSPPYP00000016297	0.804	Protein phosphatase 2, regulatory subunit B, gamma
18	9601.ENSPPYP00000003235	0.803	Protein phosphatase 2, regulatory subunit B, delta
19	9601.ENSPPYP00000017801	0.803	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
20	9601.ENSPPYP00000020683	0.803	Protein phosphatase 2, regulatory subunit B, alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004672	0.998	protein kinase activity
GO:0004674	0.969	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007154	0.992	cell communication
GO:0050794	0.990	regulation of cellular process
GO:0023052	0.988	signaling
GO:0050896	0.986	response to stimulus
GO:0019222	0.908	regulation of metabolic process
GO:0030111	0.902	regulation of Wnt signaling pathway
GO:0051716	0.900	cellular response to stimulus
GO:0060255	0.897	regulation of macromolecule metabolic process
GO:0060828	0.893	regulation of canonical Wnt signaling pathway
GO:0071704	0.891	organic substance metabolic process
GO:0051171	0.881	regulation of nitrogen compound metabolic process
GO:0035556	0.876	intracellular signal transduction
GO:0030178	0.867	negative regulation of Wnt signaling pathway
GO:0080090	0.864	regulation of primary metabolic process
GO:0031323	0.864	regulation of cellular metabolic process
GO:0032502	0.851	developmental process
GO:0006807	0.851	nitrogen compound metabolic process
GO:0043170	0.833	macromolecule metabolic process
GO:0012501	0.820	programmed cell death
GO:0065009	0.805	regulation of molecular function
GO:0048518	0.803	positive regulation of biological process
GO:0048856	0.791	anatomical structure development
GO:0044238	0.757	primary metabolic process
GO:0044237	0.751	cellular metabolic process
GO:0006915	0.746	apoptotic process
GO:0043412	0.728	macromolecule modification
GO:0048522	0.718	positive regulation of cellular process
GO:0051246	0.698	regulation of protein metabolic process
GO:0032501	0.647	multicellular organismal process
GO:1901564	0.639	organonitrogen compound metabolic process
GO:0019538	0.633	protein metabolic process
GO:0006793	0.598	phosphorus metabolic process
GO:0036211	0.555	protein modification process
GO:0031399	0.523	regulation of protein modification process
GO:0007275	0.522	multicellular organism development
GO:0009893	0.517	positive regulation of metabolic process
GO:0051173	0.513	positive regulation of nitrogen compound metabolic process
GO:0042981	0.510	regulation of apoptotic process
GO:0006796	0.504	phosphate-containing compound metabolic process
GO:0065008	0.476	regulation of biological quality
GO:0010604	0.467	positive regulation of macromolecule metabolic process
GO:0071840	0.466	cellular component organization or biogenesis
GO:0031325	0.462	positive regulation of cellular metabolic process
GO:0019220	0.461	regulation of phosphate metabolic process
GO:0010468	0.450	regulation of gene expression
GO:0048731	0.400	system development
GO:0042221	0.391	response to chemical
GO:0016043	0.383	cellular component organization
GO:0051239	0.381	regulation of multicellular organismal process
GO:0090090	0.378	negative regulation of canonical Wnt signaling pathway
GO:0031647	0.372	regulation of protein stability
GO:0043065	0.336	positive regulation of apoptotic process
GO:0050821	0.327	protein stabilization
GO:0050793	0.325	regulation of developmental process
GO:0001932	0.325	regulation of protein phosphorylation
GO:0050790	0.315	regulation of catalytic activity
GO:0010605	0.308	negative regulation of macromolecule metabolic process
GO:0051247	0.301	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.968	intracellular organelle
GO:0043227	0.958	membrane-bounded organelle
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0005634	0.893	nucleus
GO:0005829	0.847	cytosol
GO:0032991	0.766	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.

[back to server]