StarFunc result for job id Q13191

User Input

>input (982 residues)
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B9EKI5	0.352	0.367	0.000	938	0.912	0.955	B9EKI5.pdb.gz	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
2	AFDB:Q13191	1.000	1.000	0.000	982	1.000	1.000	Q13191.pdb.gz	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
3	AFDB:P22682	0.414	0.445	1.625E-73	913	0.496	0.533	P22682.pdb.gz	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
4	AFDB:F1QI90	0.407	0.437	1.678E-71	913	0.490	0.527	F1QI90.pdb.gz
5	AFDB:Q98TY6	0.331	0.357	8.853E-71	903	0.490	0.533	Q98TY6.pdb.gz	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:Q9ULV8	0.384	0.778	3.328E-44	474	0.217	0.449	Q9ULV8.pdb.gz	CBLC_HUMAN E3 ubiquitin-protein ligase CBL-C OS=Homo sapiens OX=9606 GN=CBLC PE=1 SV=3
7	PDB:1k9aB	0.070	0.152	6.099E-2	441	0.013	0.029	1k9aB.pdb.gz
8	PDB:3ps5A	0.069	0.123	6.099E-2	529	0.032	0.059	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
9	PDB:4k2rA	0.074	0.127	7.094E-2	551	0.029	0.051	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
10	PDB:4fl2A	0.055	0.096	8.252E-2	555	0.012	0.022	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
11	PDB:5xzrA	0.068	0.125	1.117E-1	519	0.014	0.027	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	AFDB:Q05A80	0.052	0.050	1.257E-1	1031	0.140	0.133	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
13	PDB:4gwfA	0.066	0.128	1.366E-1	497	0.013	0.026	4gwfA.pdb.gz
14	AFDB:H2KYH3	0.067	0.032	1.978E-1	2476	0.118	0.047	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
15	PDB:1griA	0.055	0.243	2.150E-1	211	0.009	0.043	1griA.pdb.gz
16	PDB:5dkaA	0.047	0.427	2.378E-1	96	0.015	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:1ka6A	0.053	0.437	2.631E-1	107	0.011	0.103	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
18	PDB:4r8pL	0.055	0.194	2.767E-1	254	0.023	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	AFDB:Q6IMN6	0.058	0.052	9.436E-1	1127	0.129	0.113	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
20	AFDB:Q5SSZ7	0.045	0.048	1.098	913	0.105	0.113	Q5SSZ7.pdb.gz	ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus OX=10090 GN=Znrf3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RR39	0.0	731	862	0.343	0.391	A0A0U1RR39_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=1
2	A0A0U1ZFN5	0.0	669	846	0.314	0.364	A0A0U1ZFN5_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
3	A0A8I5ZWU2	0.0	669	802	0.315	0.385	A0A8I5ZWU2_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
4	A0A8I6AFF7	0.0	747	825	0.377	0.448	A0A8I6AFF7_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
5	A0A8I6G3R2	0.0	749	914	0.377	0.405	A0A8I6G3R2_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
6	A0A8I6G861	0.0	731	870	0.342	0.386	A0A8I6G861_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=1
7	B9EKI5	0.0	1593	938	0.912	0.955	B9EKI5_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=1
8	D3ZV15	0.0	748	894	0.377	0.414	D3ZV15_RAT E3 ubiquitin-protein ligase CBL OS=Rattus norvegicus OX=10116 GN=Cbl PE=1 SV=2
9	O46034	0.0	637	448	0.297	0.652	O46034_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=1
10	P22681	0.0	771	906	0.484	0.524	CBL_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2
11	P22682	0.0	750	913	0.377	0.405	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3
12	P91683	0.0	638	448	0.298	0.654	P91683_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=1
13	Q13191	0.0	2009	982	1.000	1.000	CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens OX=9606 GN=CBLB PE=1 SV=2
14	Q3TTA7	0.0	1654	982	0.951	0.951	CBLB_MOUSE E3 ubiquitin-protein ligase CBL-B OS=Mus musculus OX=10090 GN=Cblb PE=1 SV=3
15	Q5U376	0.0	737	913	0.350	0.377	Q5U376_DANRE E3 ubiquitin-protein ligase CBL OS=Danio rerio OX=7955 GN=wu:fd16a12 PE=2 SV=1
16	Q8K4S7	0.0	1547	938	0.873	0.914	CBLB_RAT E3 ubiquitin-protein ligase CBL-B OS=Rattus norvegicus OX=10116 GN=Cblb PE=1 SV=1
17	Q98TY6	0.0	758	903	0.390	0.424	Q98TY6_CHICK E3 ubiquitin-protein ligase CBL OS=Gallus gallus OX=9031 PE=2 SV=1
18	Q9VSK2	0.0	647	878	0.294	0.329	Q9VSK2_DROME E3 ubiquitin-protein ligase CBL OS=Drosophila melanogaster OX=7227 GN=Cbl PE=2 SV=2
19	Q6ABG8	3.22e-156	473	523	0.243	0.457	Q6ABG8_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1
20	Q95ZR5	1.37e-155	473	565	0.226	0.393	Q95ZR5_CAEEL E3 ubiquitin-protein ligase CBL OS=Caenorhabditis elegans OX=6239 GN=sli-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02262 Cbl_N	2e-50	181.3	CBL proto-oncogene N-terminal domain 1
2	PF02761 Cbl_N2	5.4e-37	137.6	CBL proto-oncogene N-terminus, EF hand-like domain
3	PF02762 Cbl_N3	4.6e-43	156.3	CBL proto-oncogene N-terminus, SH2-like domain
4	PF14447 Prok-RING_4	1.3e-10	52.3	Prokaryotic RING finger family 4
5	PF00627 UBA	3.6e+02	12.5	UBA/TS-N domain
6	PF00097 zf-C3HC4	4.5e-05	34.6	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.73	21.0	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	8.9e-07	40.0	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	1.7e+02	13.7	zinc finger of C3HC4-type, RING
10	PF12678 zf-rbx1	2e+02	13.7	RING-H2 zinc finger domain
11	PF13639 zf-RING_2	9.4e-05	34.0	Ring finger domain
12	PF14570 zf-RING_4	6e+02	11.6	RING/Ubox like zinc-binding domain
13	PF14634 zf-RING_5	21	16.5	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	5.4	18.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264122

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.997	Epidermal growth factor receptor
2	9606.ENSP00000264972	0.987	Tyrosine-protein kinase ZAP-70
3	9606.ENSP00000380921	0.985	SH3 domain-containing kinase-binding protein 1
4	9606.ENSP00000364907	0.981	Tyrosine-protein kinase SYK
5	9606.ENSP00000428056	0.981	Phosphatidylinositol 3-kinase regulatory subunit alpha
6	9606.ENSP00000376345	0.980	Growth factor receptor-bound protein 2
7	9606.ENSP00000441543	0.974	Polyubiquitin-C
8	9606.ENSP00000381717	0.965	Ubiquitin-conjugating enzyme E2 D2
9	9606.ENSP00000433623	0.937	TNF receptor-associated factor 6
10	9606.ENSP00000247668	0.931	TNF receptor-associated factor 2
11	9606.ENSP00000451828	0.927	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000278888	0.923	High affinity immunoglobulin epsilon receptor subunit beta
13	9606.ENSP00000428924	0.921	Tyrosine-protein kinase Lyn
14	9606.ENSP00000346671	0.917	Tyrosine-protein kinase Fyn
15	9606.ENSP00000264033	0.913	E3 ubiquitin-protein ligase CBL
16	9606.ENSP00000352121	0.911	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
17	9606.ENSP00000361359	0.909	Tumor necrosis factor receptor superfamily member 5
18	9606.ENSP00000263967	0.905	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
19	9606.ENSP00000289902	0.904	High affinity immunoglobulin epsilon receptor subunit gamma
20	9606.ENSP00000289153	0.902	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.936	catalytic activity
GO:0016740	0.928	transferase activity
GO:0140096	0.922	catalytic activity, acting on a protein
GO:0019899	0.916	enzyme binding
GO:0008270	0.826	zinc ion binding
GO:0019901	0.696	protein kinase binding
GO:0061630	0.582	ubiquitin protein ligase activity
GO:0019904	0.491	protein domain specific binding
GO:0017124	0.309	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0007154	0.988	cell communication
GO:0023052	0.982	signaling
GO:0048856	0.967	anatomical structure development
GO:0048519	0.954	negative regulation of biological process
GO:0007165	0.949	signal transduction
GO:0048523	0.925	negative regulation of cellular process
GO:0071704	0.903	organic substance metabolic process
GO:0048518	0.896	positive regulation of biological process
GO:0044238	0.893	primary metabolic process
GO:0019222	0.893	regulation of metabolic process
GO:0048583	0.879	regulation of response to stimulus
GO:0032501	0.864	multicellular organismal process
GO:0001775	0.853	cell activation
GO:0042221	0.850	response to chemical
GO:0060255	0.826	regulation of macromolecule metabolic process
GO:0006807	0.818	nitrogen compound metabolic process
GO:0010033	0.812	response to organic substance
GO:0007166	0.805	cell surface receptor signaling pathway
GO:0048584	0.802	positive regulation of response to stimulus
GO:0048522	0.792	positive regulation of cellular process
GO:0043170	0.789	macromolecule metabolic process
GO:0006950	0.781	response to stress
GO:0023051	0.772	regulation of signaling
GO:0010646	0.770	regulation of cell communication
GO:0009966	0.758	regulation of signal transduction
GO:0051179	0.751	localization
GO:0032446	0.750	protein modification by small protein conjugation
GO:0045321	0.736	leukocyte activation
GO:0009719	0.732	response to endogenous stimulus
GO:0070887	0.726	cellular response to chemical stimulus
GO:0080090	0.722	regulation of primary metabolic process
GO:0009605	0.720	response to external stimulus
GO:0051171	0.715	regulation of nitrogen compound metabolic process
GO:0009893	0.712	positive regulation of metabolic process
GO:0051234	0.705	establishment of localization
GO:1901700	0.705	response to oxygen-containing compound
GO:0002682	0.678	regulation of immune system process
GO:0051239	0.675	regulation of multicellular organismal process
GO:0033554	0.666	cellular response to stress
GO:0010604	0.622	positive regulation of macromolecule metabolic process
GO:0006810	0.608	transport
GO:0009628	0.584	response to abiotic stimulus
GO:0051641	0.575	cellular localization
GO:0031323	0.500	regulation of cellular metabolic process
GO:0051246	0.465	regulation of protein metabolic process
GO:1902531	0.464	regulation of intracellular signal transduction
GO:0071495	0.445	cellular response to endogenous stimulus
GO:0044237	0.440	cellular metabolic process
GO:0051169	0.436	nuclear transport
GO:0016567	0.427	protein ubiquitination
GO:0051247	0.425	positive regulation of protein metabolic process
GO:0033365	0.418	protein localization to organelle
GO:0031399	0.417	regulation of protein modification process
GO:0065009	0.403	regulation of molecular function
GO:0051249	0.381	regulation of lymphocyte activation
GO:0002684	0.373	positive regulation of immune system process
GO:0051170	0.373	import into nucleus
GO:0007275	0.361	multicellular organism development
GO:0034504	0.360	protein localization to nucleus
GO:0010468	0.355	regulation of gene expression
GO:1901701	0.332	cellular response to oxygen-containing compound
GO:0050790	0.330	regulation of catalytic activity
GO:0010941	0.330	regulation of cell death
GO:0042127	0.325	regulation of cell population proliferation
GO:0050863	0.325	regulation of T cell activation
GO:0030155	0.303	regulation of cell adhesion
GO:0070848	0.301	response to growth factor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.995	plasma membrane
GO:0005829	0.994	cytosol
GO:0005654	0.992	nucleoplasm
GO:0098857	0.642	membrane microdomain
GO:0045121	0.617	membrane raft
GO:0012505	0.467	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.928	Transferases.

[back to server]