StarFunc result for job id Q13201

User Input

>input (1228 residues)
MKGARLFVLLSSLWSGGIGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRV
MSAEIATTPEARTSEDSLLKSTLPPSETSAPAEGVRNQTLTSTEKAEGVVKLQNLTLPTN
ASIKFNPGAESVVLSNSTLKFLQSFARKSNEQATSLNTVGGTGGIGGVGGTGGVGNRAPR
ETYLSRGDSSSSQRTDYQKSNFETTRGKNWCAYVHTRLSPTVILDNQVTYVPGGKGPCGW
TGGSCPQRSQKISNPVYRMQHKIVTSLDWRCCPGYSGPKCQLRAQEQQSLIHTNQAESHT
AVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLE
GKVSEDKSREFQSLLKGLKSKSINVLIRDIVREQFKIFQNDMQETVAQLFKTVSSLSEDL
ESTRQIIQKVNESVVSIAAQQKFVLVQENRPTLTDIVELRNHIVNVRQEMTLTCEKPIKE
LEVKQTHLEGALEQEHSRSILYYESLNKTLSKLKEVHEQLLSTEQVSDQKNAPAAESVSN
NVTEYMSTLHENIKKQSLMMLQMFEDLHIQESKINNLTVSLEMEKESLRGECEDMLSKCR
NDFKFQLKDTEENLHVLNQTLAEVLFPMDNKMDKMSEQLNDLTYDMEILQPLLEQGASLR
QTMTYEQPKEAIVIRKKIENLTSAVNSLNFIIKELTKRHNLLRNEVQGRDDALERRINEY
ALEMEDGLNKTMTIINNAIDFIQDNYALKETLSTIKDNSEIHHKCTSDMETILTFIPQFH
RLNDSIQTLVNDNQRYNFVLQVAKTLAGIPRDEKLNQSNFQKMYQMFNETTSQVRKYQQN
MSHLEEKLLLTTKISKNFETRLQDIESKVTQTLIPYYISVKKGSVVTNERDQALQLQVLN
SRFKALEAKSIHLSINFFSLNKTLHEVLTMCHNASTSVSELNATIPKWIKHSLPDIQLLQ
KGLTEFVEPIIQIKTQAALSNLTCCIDRSLPGSLANVVKSQKQVKSLPKKINALKKPTVN
LTTVLIGRTQRNTDNIIYPEEYSSCSRHPCQNGGTCINGRTSFTCACRHPFTGDNCTIKL
VEENALAPDFSKGSYRYAPMVAFFASHTYGMTIPGPILFNNLDVNYGASYTPRTGKFRIP
YLGVYVFKYTIESFSAHISGFLVVDGIDKLAFESENINSEIHCDRVLTGDALLELNYGQE
VWLRLAKGTIPAKFPPVTTFSGYLLYRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13201	1.000	1.000	0.000	1228	1.000	1.000	Q13201.pdb.gz	MMRN1_HUMAN Multimerin-1 OS=Homo sapiens OX=9606 GN=MMRN1 PE=1 SV=3
2	PDB:5h4bA	0.097	0.798	2.915E-9	136	0.026	0.235	5h4bA.pdb.gz
3	PDB:5kc6B	0.097	0.751	1.609E-8	144	0.022	0.188	5kc6B.pdb.gz
4	AFDB:Q54VD6	0.066	0.056	2.409E-7	1539	0.125	0.099	Q54VD6.pdb.gz	Q54VD6_DICDI Dynactin 150 kDa subunit OS=Dictyostelium discoideum OX=44689 GN=dynA PE=3 SV=1
5	AFDB:B9EKI3	0.086	0.096	2.437E-6	1091	0.133	0.149	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
6	AFDB:Q5HZI1	0.060	0.060	2.575E-6	1210	0.107	0.109	Q5HZI1.pdb.gz	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
7	AFDB:A0A024R370	0.081	0.089	3.787E-6	1093	0.133	0.149	A0A024R370.pdb.gz
8	AFDB:A0A2R8Y7M0	0.070	0.082	6.218E-6	985	0.097	0.121	A0A2R8Y7M0.pdb.gz	A0A2R8Y7M0_HUMAN TATA element modulatory factor 1 OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=1
9	AFDB:Q5JR59	0.096	0.087	6.570E-6	1369	0.097	0.087	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
10	AFDB:P25067	0.111	0.185	6.942E-6	703	0.039	0.068	P25067.pdb.gz	CO8A2_HUMAN Collagen alpha-2(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=2
11	AFDB:B9EK46	0.095	0.096	1.021E-5	1203	0.138	0.140	B9EK46.pdb.gz	B9EK46_HUMAN Cingulin OS=Homo sapiens OX=9606 GN=CGN PE=1 SV=1
12	AFDB:Q4ZJM7	0.104	0.254	2.605E-5	482	0.037	0.093	Q4ZJM7.pdb.gz	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
13	PDB:7e57B	0.067	0.592	4.799E-4	123	0.011	0.114	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:6oj0A	0.074	0.374	1.172E-2	178	0.015	0.107	6oj0A.pdb.gz
15	PDB:2waaA	0.059	0.179	1.383E-2	335	0.010	0.036	2waaA.pdb.gz
16	PDB:5a3oA	0.059	0.483	1.383E-2	114	0.010	0.105	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
17	PDB:6xwuA	0.036	0.163	2.830E-2	138	0.009	0.080	6xwuA.pdb.gz
18	PDB:7l2zF	0.052	0.088	2.830E-2	664	0.007	0.014	7l2zF.pdb.gz
19	PDB:3i26D	0.066	0.173	3.728E-2	369	0.013	0.043	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
20	PDB:4uybA	0.047	0.119	3.728E-2	401	0.010	0.030	4uybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RPV6	0.0	1642	1210	0.656	0.665	MMRN1_MOUSE Multimerin-1 OS=Mus musculus OX=10090 GN=Mmrn1 PE=1 SV=2
2	Q13201	0.0	2554	1228	1.000	1.000	MMRN1_HUMAN Multimerin-1 OS=Homo sapiens OX=9606 GN=MMRN1 PE=1 SV=3
3	Q9Y6C2	2.14e-15	84.0	1016	0.049	0.059	EMIL1_HUMAN EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3
4	Q5TZ63	3.90e-13	76.6	1008	0.037	0.045	Q5TZ63_DANRE EMILIN-1 precursor OS=Danio rerio OX=7955 GN=im:7159005 PE=1 SV=1
5	F1QC17	5.98e-13	76.3	1014	0.037	0.044	EMI1A_DANRE EMILIN-1-A OS=Danio rerio OX=7955 GN=emilin1a PE=3 SV=1
6	Q99K41	6.97e-13	75.9	1017	0.043	0.052	EMIL1_MOUSE EMILIN-1 OS=Mus musculus OX=10090 GN=Emilin1 PE=1 SV=1
7	A6H6E2	9.69e-13	75.5	943	0.034	0.045	MMRN2_MOUSE Multimerin-2 OS=Mus musculus OX=10090 GN=Mmrn2 PE=1 SV=1
8	Q9H8L6	6.92e-12	72.8	949	0.034	0.044	MMRN2_HUMAN Multimerin-2 OS=Homo sapiens OX=9606 GN=MMRN2 PE=1 SV=2
9	Q8K482	1.54e-09	65.1	1074	0.112	0.128	EMIL2_MOUSE EMILIN-2 OS=Mus musculus OX=10090 GN=Emilin2 PE=1 SV=1
10	D3ZJ76	8.67e-09	61.2	331	0.039	0.145	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
11	Q9BXX0	9.14e-09	62.4	1053	0.078	0.091	EMIL2_HUMAN EMILIN-2 OS=Homo sapiens OX=9606 GN=EMILIN2 PE=1 SV=3
12	Q05A80	1.69e-08	61.6	1031	0.033	0.039	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
13	Q6IMN6	1.82e-08	61.6	1127	0.033	0.035	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
14	Q5RJ80	3.01e-08	60.8	914	0.033	0.044	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
15	P59900	3.68e-08	60.5	758	0.024	0.038	EMIL3_MOUSE EMILIN-3 OS=Mus musculus OX=10090 GN=Emilin3 PE=2 SV=1
16	Q9BXJ3	3.74e-08	58.9	329	0.040	0.149	C1QT4_HUMAN Complement C1q tumor necrosis factor-related protein 4 OS=Homo sapiens OX=9606 GN=C1QTNF4 PE=1 SV=2
17	Q4ZJN1	9.19e-08	57.8	333	0.037	0.138	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
18	Q9BXJ4	7.23e-07	54.3	246	0.033	0.167	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
19	P0C862	9.09e-07	54.7	333	0.035	0.129	C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens OX=9606 GN=C1QTNF9 PE=1 SV=1
20	Q9ES30	1.23e-06	53.5	246	0.034	0.171	C1QT3_MOUSE Complement C1q tumor necrosis factor-related protein 3 OS=Mus musculus OX=10090 GN=C1qtnf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	1.4e-22	91.7	C1q domain
2	PF15821 DUF4709	5.8e+02	12.3	Domain of unknown function (DUF4709)
3	PF17472 DUF5425	2.8e+02	13.7	Family of unknown function (DUF5425)
4	PF00008 EGF	0.00022	32.8	EGF-like domain
5	PF07546 EMI	3.4e-09	48.6	EMI domain
6	PF12661 hEGF	31	16.6	Human growth factor-like EGF
7	PF05659 RPW8	15	16.7	Arabidopsis broad-spectrum mildew resistance protein RPW8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356771	0.832	Coagulation factor V
2	9606.ENSP00000466070	0.633	Ly6/PLAUR domain-containing protein 8
3	9606.ENSP00000387882	0.627	Synaptotagmin like tandem C2 proteins
4	9606.ENSP00000261405	0.557	Von Willebrand factor
5	9606.ENSP00000215531	0.537	Small integral membrane protein 24
6	9606.ENSP00000476603	0.521	G protein-regulated inducer of neurite outgrowth 3
7	9606.ENSP00000434847	0.506	Tsukushin
8	9606.ENSP00000264663	0.500	NAD(P) transhydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.991	cellular process
GO:1903035	0.977	negative regulation of response to wounding
GO:0022407	0.976	regulation of cell-cell adhesion
GO:0061041	0.976	regulation of wound healing
GO:0010543	0.976	regulation of platelet activation
GO:0032102	0.975	negative regulation of response to external stimulus
GO:0034110	0.971	regulation of homotypic cell-cell adhesion
GO:0048518	0.966	positive regulation of biological process
GO:0061045	0.959	negative regulation of wound healing
GO:0065008	0.956	regulation of biological quality
GO:0032501	0.952	multicellular organismal process
GO:0048522	0.950	positive regulation of cellular process
GO:0050878	0.922	regulation of body fluid levels
GO:0050896	0.917	response to stimulus
GO:0022409	0.916	positive regulation of cell-cell adhesion
GO:0006950	0.833	response to stress
GO:0007596	0.583	blood coagulation
GO:0007155	0.468	cell adhesion
GO:0090330	0.378	regulation of platelet aggregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005737	0.981	cytoplasm
GO:0043227	0.978	membrane-bounded organelle
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0005576	0.971	extracellular region
GO:0012505	0.970	endomembrane system
GO:0070013	0.943	intracellular organelle lumen
GO:0031982	0.893	vesicle
GO:0032991	0.870	protein-containing complex
GO:0097708	0.865	intracellular vesicle
GO:0031410	0.863	cytoplasmic vesicle
GO:0016020	0.845	membrane
GO:0030141	0.828	secretory granule
GO:0031091	0.791	platelet alpha granule
GO:0034774	0.776	secretory granule lumen
GO:0031093	0.761	platelet alpha granule lumen
GO:0098637	0.431	protein complex involved in cell-matrix adhesion
GO:1990972	0.369	multimerin complex
GO:1903561	0.355	extracellular vesicle
GO:0005615	0.333	extracellular space
GO:0070062	0.311	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]