StarFunc result for job id Q13203

User Input

>input (477 residues)
MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAPAPQAPTASTA
TKPAPPSEDVPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPV
SARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIRENIEAPKIRVPRHL
RQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSMRTGDQDSILFIRSAQRSD
SGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLG
YMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLSTSATVTKELAH
IQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKNKM
EIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCRLEVKASAAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13203	1.000	1.000	1.842E-84	477	1.000	1.000	Q13203.pdb.gz	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4
2	AFDB:E1C597	0.436	0.390	3.003E-59	537	0.537	0.477	E1C597.pdb.gz
3	AFDB:A1L1W0	0.449	0.411	3.202E-56	523	0.470	0.428	A1L1W0.pdb.gz
4	AFDB:Q90688	0.444	0.175	4.885E-54	1272	0.436	0.164	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
5	AFDB:Q5U3B1	0.448	0.196	5.754E-53	1168	0.434	0.177	Q5U3B1.pdb.gz	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
6	AFDB:Q14324	0.426	0.187	8.020E-53	1141	0.449	0.188	Q14324.pdb.gz	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
7	AFDB:P56741	0.504	0.206	8.410E-53	1274	0.426	0.159	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
8	AFDB:A0A1L1QZU5	0.458	0.197	3.173E-52	1287	0.426	0.158	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
9	AFDB:A6QP89	0.445	0.191	3.173E-52	1198	0.455	0.181	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
10	AFDB:E7EZ79	0.451	0.179	3.489E-52	1266	0.426	0.160	E7EZ79.pdb.gz
11	PDB:1e07A	0.240	0.194	3.726E-13	642	0.122	0.090	1e07A.pdb.gz
12	PDB:5oj2B	0.195	0.143	2.155E-12	692	0.132	0.091	5oj2B.pdb.gz
13	PDB:6dldD	0.255	0.417	6.117E-12	269	0.101	0.178	6dldD.pdb.gz
14	PDB:6dlfA	0.245	0.449	3.614E-10	236	0.084	0.169	6dlfA.pdb.gz
15	PDB:7sqcO0	0.262	0.138	6.840E-9	1140	0.099	0.041	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:4aq1A	0.170	0.122	1.532E-8	721	0.082	0.054	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
17	PDB:6pxvA	0.253	0.169	1.942E-8	823	0.109	0.063	6pxvA.pdb.gz
18	PDB:1igtB	0.151	0.158	4.560E-8	444	0.147	0.158	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
19	PDB:7u05A	0.199	0.112	4.782E-8	1114	0.136	0.058	7u05A.pdb.gz
20	PDB:6feyB	0.198	0.438	5.014E-8	207	0.092	0.213	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q05623	0.0	524	537	0.495	0.439	MYBPH_CHICK Myosin-binding protein H OS=Gallus gallus OX=9031 GN=MYBPH PE=1 SV=1
2	Q13203	0.0	982	477	1.000	1.000	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4
3	Q5FW53	6.75e-171	486	355	0.468	0.628	MBPHL_MOUSE Myosin-binding protein H-like OS=Mus musculus OX=10090 GN=Mybphl PE=1 SV=1
4	A2RUH7	4.03e-170	484	354	0.480	0.647	MBPHL_HUMAN Myosin-binding protein H-like OS=Homo sapiens OX=9606 GN=MYBPHL PE=1 SV=2
5	Q6P6L5	1.28e-154	470	1124	0.457	0.194	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
6	Q90688	4.27e-154	472	1272	0.442	0.166	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
7	D3YU50	6.04e-154	468	1127	0.455	0.193	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
8	A0A571BEN1	7.17e-154	468	1139	0.455	0.191	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
9	Q14324	2.96e-153	467	1141	0.463	0.194	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
10	A6QP89	3.16e-153	468	1198	0.468	0.186	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
11	Q5BJ14	5.57e-152	462	1111	0.449	0.193	Q5BJ14_DANRE Zgc:110761 OS=Danio rerio OX=7955 GN=zgc:110761 PE=2 SV=1
12	Q00872	4.10e-151	461	1141	0.465	0.195	MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2
13	Q5XKE0	1.65e-148	454	1136	0.453	0.190	MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus OX=10090 GN=Mybpc2 PE=1 SV=1
14	A0A1L1QZU5	3.21e-147	454	1287	0.426	0.158	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
15	Q5U3B1	4.16e-144	444	1168	0.447	0.182	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
16	F7D574	1.01e-143	417	362	0.394	0.519	F7D574_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
17	Q14896	1.49e-142	442	1274	0.442	0.166	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
18	P16419	2.01e-142	438	1132	0.419	0.177	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
19	O70468	4.26e-142	441	1270	0.436	0.164	MYPC3_MOUSE Myosin-binding protein C, cardiac-type OS=Mus musculus OX=10090 GN=Mybpc3 PE=1 SV=1
20	P56741	8.75e-141	437	1274	0.436	0.163	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	3.3	19.1	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	4.5e-20	83.1	Fibronectin type III domain
3	PF01688 Herpes_gI	4.4e+02	12.2	Alphaherpesvirus glycoprotein I
4	PF07679 I-set	1.6e-29	113.1	Immunoglobulin I-set domain
5	PF00047 ig	4.7e-07	41.2	Immunoglobulin domain
6	PF13895 Ig_2	1.1e-08	46.5	Immunoglobulin domain
7	PF13927 Ig_3	1.5e-21	88.0	Immunoglobulin domain
8	PF07686 V-set	8.9e-05	34.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255416

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306190	0.988	Signaling lymphocytic activation molecule
2	9606.ENSP00000313875	0.988	Membrane cofactor protein
3	9606.ENSP00000356991	0.981	Nectin-4
4	9606.ENSP00000346659	0.936	P protein
5	9606.ENSP00000319531	0.908	Glycine cleavage system H protein, mitochondrial
6	9606.ENSP00000370737	0.894	Glycine dehydrogenase (decarboxylating), mitochondrial
7	9606.ENSP00000273588	0.865	Aminomethyltransferase, mitochondrial
8	9606.ENSP00000361636	0.792	Troponin C, skeletal muscle
9	9606.ENSP00000309463	0.740	Putative lipoyltransferase 2, mitochondrial
10	9606.ENSP00000307280	0.738	Myosin light chain 1/3, skeletal muscle isoform
11	9606.ENSP00000260010	0.705	Toll-like receptor 2
12	9606.ENSP00000299432	0.704	Putative protein MSS51 homolog, mitochondrial
13	9606.ENSP00000245907	0.689	Complement C3
14	9606.ENSP00000344242	0.671	Leucine-rich repeat-containing protein 17
15	9606.ENSP00000363089	0.665	Toll-like receptor 4
16	9606.ENSP00000418668	0.663	Caveolae-associated protein 4
17	9606.ENSP00000410157	0.662	Ankyrin repeat and BTB/POZ domain-containing protein 2
18	9606.ENSP00000256785	0.642	Complement factor H-related protein 5
19	9606.ENSP00000337439	0.625	Dapper homolog 1
20	9606.ENSP00000356399	0.606	Complement factor H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008307	1.000	structural constituent of muscle
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.980	biological regulation
GO:0050789	0.969	regulation of biological process
GO:0051239	0.791	regulation of multicellular organismal process
GO:0044057	0.766	regulation of system process
GO:0009987	0.732	cellular process
GO:0090257	0.727	regulation of muscle system process
GO:0006937	0.667	regulation of muscle contraction
GO:0032501	0.591	multicellular organismal process
GO:0006942	0.545	regulation of striated muscle contraction
GO:0050794	0.352	regulation of cellular process
GO:0032502	0.326	developmental process
GO:0048856	0.321	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0099080	0.999	supramolecular complex
GO:0099512	0.987	supramolecular fiber
GO:0030016	0.976	myofibril
GO:0043231	0.728	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]