StarFunc result for job id Q13207

User Input

>input (712 residues)
MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPPGALAKPLPDPGLAGA
AAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHK
LGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDCRYKFHNSRWMVAGKADP
EMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFTILNSMHKYQPRFHIVRAN
DILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPFAKGFRDTGNGRREKRKQLT
LPSLRLYEEHCKPERDGAESDASSCDPPPAREPPTSPGAAPSPLRLHRARAEEKSCAADS
DPEPERLSEERAGAPLGRSPAPDSASPTRLTEPERARERRSPERGKEPAESGGDGPFGLR
SLEKERAEARRKDEGRKEAAEGKEQGLAPLVVQTDSASPLGAGHLPGLAFSSHLHGQQFF
GPLGAGQPLFLHPGQFTMGPGAFSAMGMGHLLASVAGGGNGGGGGPGTAAGLDAGGLGPA
ASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPYPYTYMAAAAAAASALPATSAAAAAA
AAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLP
ELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13207	0.999	0.999	5.830E-104	712	1.000	1.000	Q13207.pdb.gz	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
2	AFDB:Q7ZTU9	0.355	0.368	2.044E-73	687	0.694	0.719	Q7ZTU9.pdb.gz	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
3	AFDB:B0R122	0.437	0.452	6.135E-72	686	0.646	0.671	B0R122.pdb.gz	B0R122_DANRE T-box transcription factor 2a OS=Danio rerio OX=7955 GN=tbx-a PE=4 SV=1
4	AFDB:A0A1D5NXF3	0.321	0.312	1.196E-57	732	0.577	0.561	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
5	AFDB:O15119	0.347	0.333	2.839E-56	743	0.566	0.542	O15119.pdb.gz	TBX3_HUMAN T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3 PE=1 SV=4
6	AFDB:A2RUW2	0.315	0.325	2.212E-55	689	0.517	0.534	A2RUW2.pdb.gz
7	AFDB:Q24432	0.289	0.215	2.817E-40	972	0.404	0.296	Q24432.pdb.gz	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
8	AFDB:Q19691	0.274	0.454	3.936E-35	423	0.239	0.402	Q19691.pdb.gz	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
9	AFDB:Q9VST2	0.265	0.401	2.930E-31	469	0.202	0.307	Q9VST2.pdb.gz	Q9VST2_DROME Dorsocross2 OS=Drosophila melanogaster OX=7227 GN=Doc2 PE=2 SV=1
10	AFDB:Q8MYX3	0.268	0.483	1.065E-30	391	0.197	0.358	Q8MYX3.pdb.gz	Q8MYX3_DROME RE59988p OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
11	PDB:7ea3J	0.094	0.078	1.852E-2	883	0.017	0.014	7ea3J.pdb.gz
12	PDB:1yycA	0.067	0.179	2.483E-2	174	0.027	0.109	1yycA.pdb.gz
13	PDB:7b0xC	0.085	0.219	2.960E-2	211	0.021	0.071	7b0xC.pdb.gz
14	PDB:5iv5BJ	0.070	0.053	3.743E-2	1004	0.020	0.014	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
15	PDB:5hp5A	0.068	0.071	4.463E-2	669	0.022	0.024	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
16	PDB:3fxiC	0.092	0.304	5.019E-2	140	0.018	0.093	3fxiC.pdb.gz
17	PDB:7nycA	0.089	0.048	8.508E-2	1542	0.024	0.011	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:7vonA	0.102	0.057	9.022E-2	1399	0.022	0.011	7vonA.pdb.gz
19	PDB:3gc3A	0.079	0.147	9.567E-2	329	0.022	0.049	3gc3A.pdb.gz
20	PDB:1ddtA	0.111	0.143	1.015E-1	523	0.028	0.038	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D5NXF3	0.0	645	732	0.590	0.574	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
2	B0R122	0.0	812	686	0.645	0.669	B0R122_DANRE T-box transcription factor 2a OS=Danio rerio OX=7955 GN=tbx-a PE=4 SV=1
3	B8JKS6	0.0	629	689	0.569	0.588	B8JKS6_DANRE T-box transcription factor 3a OS=Danio rerio OX=7955 GN=tbx-b PE=4 SV=1
4	O15119	0.0	625	743	0.586	0.561	TBX3_HUMAN T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3 PE=1 SV=4
5	P70324	0.0	658	741	0.588	0.565	TBX3_MOUSE T-box transcription factor TBX3 OS=Mus musculus OX=10090 GN=Tbx3 PE=1 SV=3
6	Q13207	0.0	1419	712	1.000	1.000	TBX2_HUMAN T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3
7	Q60707	0.0	1143	711	0.945	0.947	TBX2_MOUSE T-box transcription factor TBX2 OS=Mus musculus OX=10090 GN=Tbx2 PE=1 SV=3
8	Q7TST9	0.0	655	743	0.587	0.563	TBX3_RAT T-box transcription factor TBX3 OS=Rattus norvegicus OX=10116 GN=Tbx3 PE=1 SV=1
9	Q7ZTU9	0.0	865	687	0.692	0.718	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
10	Q24432	1.69e-122	390	972	0.253	0.185	OMB_DROME Optomotor-blind protein OS=Drosophila melanogaster OX=7227 GN=bi PE=1 SV=3
11	Q19691	1.95e-106	332	423	0.206	0.348	TBX2_CAEEL T-box protein 2 OS=Caenorhabditis elegans OX=6239 GN=tbx-2 PE=1 SV=1
12	P57082	5.00e-83	275	545	0.195	0.255	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
13	M9PBY6	8.16e-83	268	356	0.169	0.337	M9PBY6_DROME Dorsocross1, isoform B OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=4 SV=1
14	Q9U8L5	3.82e-82	268	391	0.169	0.307	Q9U8L5_DROME Dorsocross1, isoform A OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
15	Q8MYX3	1.58e-81	266	391	0.167	0.304	Q8MYX3_DROME RE59988p OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
16	O93288	1.00e-80	269	541	0.174	0.229	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
17	Q8UW76	2.00e-80	265	440	0.170	0.275	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
18	Q9VST2	4.03e-80	265	469	0.157	0.239	Q9VST2_DROME Dorsocross2 OS=Drosophila melanogaster OX=7227 GN=Doc2 PE=2 SV=1
19	Q9UMR3	8.30e-80	263	447	0.167	0.266	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
20	Q9IAK8	9.36e-80	265	492	0.177	0.256	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	1.5e-79	277.7	T-box
2	PF12598 TBX	3e-18	77.6	T-box transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240328

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.960	Histone deacetylase 1
2	9606.ENSP00000418915	0.945	Cyclin-dependent kinase inhibitor 2A
3	9606.ENSP00000327758	0.916	Homeobox protein Nkx-2.5
4	9606.ENSP00000339191	0.729	Caveolin-1
5	9606.ENSP00000239243	0.720	Homeobox protein MSX-2
6	9606.ENSP00000334458	0.720	Transcription factor GATA-4
7	9606.ENSP00000267163	0.714	Retinoblastoma-associated protein
8	9606.ENSP00000364847	0.703	Melanoma-associated antigen D1
9	9606.ENSP00000375067	0.695	Breast carcinoma-amplified sequence 3
10	9606.ENSP00000245451	0.688	Bone morphogenetic protein 4
11	9606.ENSP00000405574	0.657	F-box-like/WD repeat-containing protein TBL1XR1
12	9606.ENSP00000259989	0.653	Fibroblast growth factor binding protein 2
13	9606.ENSP00000352565	0.650	Heart- and neural crest derivatives-expressed protein 2
14	9606.ENSP00000371770	0.649	Fibroblast growth factor-binding protein 1
15	9606.ENSP00000365663	0.638	Natriuretic peptides A
16	9606.ENSP00000368924	0.633	Transcription factor AP-2-alpha
17	9606.ENSP00000484552	0.608	Gap junction alpha-5 protein
18	9606.ENSP00000368104	0.607	Bone morphogenetic protein 2
19	9606.ENSP00000306991	0.605	Hyaluronan synthase 2
20	9606.ENSP00000307321	0.585	Homeobox protein Hox-C10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0048519	0.992	negative regulation of biological process
GO:0006357	0.992	regulation of transcription by RNA polymerase II
GO:0007275	0.990	multicellular organism development
GO:0009987	0.981	cellular process
GO:0072359	0.978	circulatory system development
GO:0048513	0.977	animal organ development
GO:0009888	0.977	tissue development
GO:0048523	0.973	negative regulation of cellular process
GO:0050896	0.963	response to stimulus
GO:0009892	0.942	negative regulation of metabolic process
GO:0010605	0.933	negative regulation of macromolecule metabolic process
GO:0031324	0.925	negative regulation of cellular metabolic process
GO:0000122	0.924	negative regulation of transcription by RNA polymerase II
GO:0048518	0.892	positive regulation of biological process
GO:0009653	0.888	anatomical structure morphogenesis
GO:0048522	0.876	positive regulation of cellular process
GO:0009893	0.835	positive regulation of metabolic process
GO:0051716	0.824	cellular response to stimulus
GO:0010604	0.806	positive regulation of macromolecule metabolic process
GO:0031325	0.776	positive regulation of cellular metabolic process
GO:0051173	0.772	positive regulation of nitrogen compound metabolic process
GO:0045935	0.761	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.749	positive regulation of cellular biosynthetic process
GO:0010557	0.719	positive regulation of macromolecule biosynthetic process
GO:0051254	0.715	positive regulation of RNA metabolic process
GO:0007507	0.710	heart development
GO:0045893	0.705	positive regulation of DNA-templated transcription
GO:0044237	0.689	cellular metabolic process
GO:0009887	0.663	animal organ morphogenesis
GO:0090398	0.622	cellular senescence
GO:0035295	0.497	tube development
GO:0060429	0.496	epithelium development
GO:0009790	0.469	embryo development
GO:0007154	0.452	cell communication
GO:0045944	0.447	positive regulation of transcription by RNA polymerase II
GO:0007165	0.420	signal transduction
GO:0051239	0.417	regulation of multicellular organismal process
GO:0048568	0.374	embryonic organ development
GO:0003007	0.353	heart morphogenesis
GO:0048869	0.336	cellular developmental process
GO:0030154	0.333	cell differentiation
GO:0042127	0.312	regulation of cell population proliferation
GO:0050793	0.300	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.772	cytoplasm
GO:0043233	0.521	organelle lumen
GO:0031981	0.512	nuclear lumen
GO:0005654	0.474	nucleoplasm
GO:0032991	0.320	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]