StarFunc result for job id Q13216

User Input

>input (396 residues)
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA
WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13216	1.000	1.000	6.727E-82	396	1.000	1.000	Q13216.pdb.gz	ERCC8_HUMAN DNA excision repair protein ERCC-8 OS=Homo sapiens OX=9606 GN=ERCC8 PE=1 SV=1
2	AFDB:Q8CFD5	0.925	0.922	1.105E-74	397	0.896	0.894	Q8CFD5.pdb.gz	ERCC8_MOUSE DNA excision repair protein ERCC-8 OS=Mus musculus OX=10090 GN=Ercc8 PE=1 SV=2
3	PDB:4a11B	0.918	0.996	2.488E-71	365	0.922	1.000	4a11B.pdb.gz
4	AFDB:A8KBN5	0.929	0.919	3.101E-65	400	0.720	0.713	A8KBN5.pdb.gz
5	AFDB:A0A2R8Q1A4	0.821	0.872	2.294E-53	372	0.654	0.696	A0A2R8Q1A4.pdb.gz
6	AFDB:F4HUT3	0.858	0.755	5.890E-41	451	0.364	0.319	F4HUT3.pdb.gz	F4HUT3_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATCSA-1 PE=1 SV=1
7	AFDB:Q9USR0	0.864	0.847	1.156E-39	404	0.323	0.317	Q9USR0.pdb.gz	CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ckn1 PE=1 SV=1
8	AFDB:Q551N8	0.859	0.666	1.250E-38	513	0.333	0.257	Q551N8.pdb.gz	Q551N8_DICDI WD40 repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=ercc8 PE=4 SV=1
9	AFDB:O18640	0.683	0.843	2.782E-23	318	0.162	0.201	O18640.pdb.gz	GBLP_DROME Small ribosomal subunit protein RACK1 OS=Drosophila melanogaster OX=7227 GN=Rack1 PE=1 SV=2
10	AFDB:P46800	0.702	0.837	3.850E-23	329	0.167	0.201	P46800.pdb.gz	GBLP_DICDI Small ribosomal subunit protein RACK1 OS=Dictyostelium discoideum OX=44689 GN=gpbB PE=1 SV=2
11	AFDB:Q9M2Z2	0.701	0.867	6.614E-23	317	0.169	0.211	Q9M2Z2.pdb.gz	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
12	PDB:5mzhB	0.635	0.609	1.384E-22	415	0.174	0.166	5mzhB.pdb.gz
13	PDB:2h9lA	0.672	0.823	3.473E-22	321	0.174	0.215	2h9lA.pdb.gz
14	PDB:4v6wAg	0.695	0.857	3.666E-22	318	0.159	0.198	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:5nnzA	0.589	0.681	1.273E-21	335	0.169	0.200	5nnzA.pdb.gz
16	PDB:6bk8D	0.677	0.744	2.186E-21	359	0.179	0.198	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:7pzyh	0.667	0.841	3.559E-21	311	0.179	0.228	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
18	PDB:7bt6x	0.587	0.487	6.981E-20	488	0.182	0.148	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
19	PDB:5jcsq	0.600	0.497	7.779E-20	488	0.187	0.152	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
20	PDB:3dm0A	0.685	0.411	8.669E-20	675	0.174	0.102	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13216	0.0	826	396	1.000	1.000	ERCC8_HUMAN DNA excision repair protein ERCC-8 OS=Homo sapiens OX=9606 GN=ERCC8 PE=1 SV=1
2	Q5XJ81	0.0	614	400	0.735	0.728	Q5XJ81_DANRE DNA excision repair protein ERCC-8 OS=Danio rerio OX=7955 GN=zgc:103550 PE=2 SV=1
3	Q8CFD5	0.0	760	397	0.899	0.897	ERCC8_MOUSE DNA excision repair protein ERCC-8 OS=Mus musculus OX=10090 GN=Ercc8 PE=1 SV=2
4	A0A8I6A7R7	4.04e-126	363	195	0.427	0.867	A0A8I6A7R7_RAT ERCC excision repair 8, CSA ubiquitin ligase complex subunit OS=Rattus norvegicus OX=10116 GN=Ercc8 PE=4 SV=1
5	G3V7B8	3.08e-118	342	176	0.409	0.920	G3V7B8_RAT ERCC excision repair 8, CSA ubiquitin ligase complex subunit OS=Rattus norvegicus OX=10116 GN=Ercc8 PE=4 SV=4
6	B1WBX3	8.21e-118	342	184	0.414	0.891	B1WBX3_RAT ERCC excision repair 8, CSA ubiquitin ligase complex subunit OS=Rattus norvegicus OX=10116 GN=Ercc8 PE=2 SV=1
7	A0A8I5ZNR2	5.96e-114	332	172	0.399	0.919	A0A8I5ZNR2_RAT ERCC excision repair 8, CSA ubiquitin ligase complex subunit OS=Rattus norvegicus OX=10116 GN=Ercc8 PE=4 SV=1
8	Q9USR0	1.57e-77	247	404	0.354	0.347	CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ckn1 PE=1 SV=1
9	Q93ZG3	9.73e-50	176	450	0.210	0.184	ACSA1_ARATH WD repeat-containing protein ATCSA-1 OS=Arabidopsis thaliana OX=3702 GN=ATCSA-1 PE=1 SV=1
10	F4HUT3	1.06e-49	176	451	0.210	0.184	F4HUT3_ARATH Transducin/WD40 repeat-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATCSA-1 PE=1 SV=1
11	A0A0S2Z3P2	1.93e-44	151	98	0.177	0.714	A0A0S2Z3P2_HUMAN Excision repair cross-complementing rodent repair deficiency complementation group 8 isoform 3 OS=Homo sapiens OX=9606 GN=ERCC8 PE=1 SV=1
12	Q551N8	1.89e-38	146	513	0.212	0.164	Q551N8_DICDI WD40 repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=ercc8 PE=4 SV=1
13	O22469	1.19e-13	74.3	424	0.134	0.125	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
14	Q3Y8L7	3.75e-13	72.8	446	0.197	0.175	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
15	Q12021	6.31e-13	72.4	506	0.131	0.103	RAD28_YEAST Radiation-sensitive protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD28 PE=1 SV=1
16	Q24572	8.64e-13	71.6	430	0.149	0.137	CAF1_DROME Chromatin assembly factor 1 p55 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-55 PE=1 SV=1
17	Q95RJ9	8.71e-13	72.4	700	0.189	0.107	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
18	O22826	1.34e-12	70.5	343	0.197	0.227	O22826_ARATH At2g43770 OS=Arabidopsis thaliana OX=3702 GN=At2g43770 PE=1 SV=1
19	Q54KL5	1.68e-12	70.1	335	0.146	0.173	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
20	Q8C092	3.97e-12	70.1	801	0.177	0.087	TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	9.4e-07	40.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16151 DUF4859	2e+02	13.3	Domain of unknown function (DUF4859)
3	PF20426 NBCH_WD40	0.58	20.5	Neurobeachin beta propeller domain
4	PF11715 Nup160	6.2	17.1	Nucleoporin Nup120/160
5	PF00400 WD40	6.5e-19	79.1	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003414

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002855	0.996	Damage-specific DNA binding protein 1, 127kDa
2	61853.ENSNLEP00000000861	0.980	Cullin 4A
3	61853.ENSNLEP00000018741	0.973	Ring finger and WD repeat domain 2, E3 ubiquitin protein ligase
4	61853.ENSNLEP00000013925	0.970	Uncharacterized protein
5	61853.ENSNLEP00000018254	0.960	Cullin 4B
6	61853.ENSNLEP00000019209	0.954	ERCC excision repair 6, chromatin remodeling factor
7	61853.ENSNLEP00000002490	0.946	ERCC excision repair 1, endonuclease non-catalytic subunit
8	61853.ENSNLEP00000018730	0.946	Ring-box 1, E3 ubiquitin protein ligase
9	61853.ENSNLEP00000021033	0.945	RAD23 homolog B, nucleotide excision repair protein
10	61853.ENSNLEP00000009596	0.936	annotation not available
11	61853.ENSNLEP00000012458	0.934	ERCC excision repair 4, endonuclease catalytic subunit
12	61853.ENSNLEP00000018935	0.934	X-ray repair complementing defective repair in Chinese hamster cells 6
13	61853.ENSNLEP00000005405	0.923	DDB1 and CUL4 associated factor 7
14	61853.ENSNLEP00000011566	0.919	WD and tetratricopeptide repeats 1
15	61853.ENSNLEP00000018049	0.919	DDB1 and CUL4 associated factor 6
16	61853.ENSNLEP00000009575	0.918	Basic, immunoglobulin-like variable motif containing
17	61853.ENSNLEP00000016825	0.917	Centrin, EF-hand protein, 2
18	61853.ENSNLEP00000019016	0.916	ERCC excision repair 3, TFIIH core complex helicase subunit
19	61853.ENSNLEP00000001281	0.913	UV-stimulated scaffold protein A
20	61853.ENSNLEP00000006948	0.910	DET1 and DDB1 associated 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.624	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009411	0.996	response to UV
GO:0065007	0.702	biological regulation
GO:0009987	0.691	cellular process
GO:0050789	0.689	regulation of biological process
GO:0071704	0.666	organic substance metabolic process
GO:0044238	0.611	primary metabolic process
GO:0043170	0.602	macromolecule metabolic process
GO:0006807	0.587	nitrogen compound metabolic process
GO:0044237	0.575	cellular metabolic process
GO:0050794	0.516	regulation of cellular process
GO:0051716	0.382	cellular response to stimulus
GO:0090304	0.369	nucleic acid metabolic process
GO:0019222	0.330	regulation of metabolic process
GO:0033554	0.329	cellular response to stress
GO:0044260	0.327	cellular macromolecule metabolic process
GO:0060255	0.316	regulation of macromolecule metabolic process
GO:0006974	0.311	cellular response to DNA damage stimulus
GO:0051171	0.310	regulation of nitrogen compound metabolic process
GO:0080090	0.306	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:0000151	0.982	ubiquitin ligase complex
GO:0031461	0.968	cullin-RING ubiquitin ligase complex
GO:0140513	0.948	nuclear protein-containing complex
GO:0080008	0.905	Cul4-RING E3 ubiquitin ligase complex
GO:0005737	0.675	cytoplasm
GO:0000109	0.656	nucleotide-excision repair complex
GO:0016363	0.647	nuclear matrix
GO:0043232	0.305	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]