StarFunc result for job id Q13217

User Input

>input (504 residues)
MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQF
HAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK
LDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKI
LEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKNDNTEAFYKISTLYYQLGDHEL
SLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPS
IAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAYLIEEMYDEAI
QDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHR
SWNSWQGFNPFSSGGPFRFKFHFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13217	1.000	1.000	3.049E-57	504	1.000	1.000	Q13217.pdb.gz	DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1
2	PDB:2y4uA	0.675	0.788	9.699E-41	424	0.829	0.986	2y4uA.pdb.gz
3	AFDB:Q9VHA8	0.788	0.797	1.447E-31	498	0.427	0.432	Q9VHA8.pdb.gz	Q9VHA8_DROME LD25575p OS=Drosophila melanogaster OX=7227 GN=P58IPK PE=1 SV=1
4	AFDB:P91189	0.655	0.671	1.318E-29	491	0.444	0.456	P91189.pdb.gz	P91189_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-7 PE=1 SV=1
5	AFDB:A0A0P0VG31	0.487	0.508	4.186E-21	476	0.268	0.284	A0A0P0VG31.pdb.gz	DJC16_ORYSJ DnaJ protein P58IPK homolog A OS=Oryza sativa subsp. japonica OX=39947 GN=P58A PE=1 SV=1
6	AFDB:A0A6I8PU73	0.435	0.440	2.646E-20	497	0.266	0.270	A0A6I8PU73.pdb.gz	A0A6I8PU73_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
7	AFDB:Q9LYW9	0.470	0.487	4.766E-20	482	0.270	0.282	Q9LYW9.pdb.gz	DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana OX=3702 GN=P58IPK PE=1 SV=1
8	AFDB:Q54IP0	0.436	0.415	8.929E-20	539	0.236	0.221	Q54IP0.pdb.gz	DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum OX=44689 GN=dnajc7 PE=1 SV=1
9	AFDB:Q9HGM9	0.446	0.469	8.457E-18	476	0.262	0.277	Q9HGM9.pdb.gz	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
10	AFDB:Q38BB1	0.475	0.479	3.472E-17	499	0.214	0.216	Q38BB1.pdb.gz	Q38BB1_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2300 PE=4 SV=1
11	AFDB:Q584G5	0.438	0.330	7.914E-17	705	0.194	0.139	Q584G5.pdb.gz	Q584G5_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.310 PE=4 SV=1
12	PDB:7ntfA	0.318	0.189	7.925E-9	918	0.137	0.075	7ntfA.pdb.gz
13	PDB:7dhgC	0.232	0.248	8.572E-9	470	0.151	0.162	7dhgC.pdb.gz
14	PDB:7qdrB	0.233	0.117	1.879E-8	1212	0.149	0.062	7qdrB.pdb.gz
15	PDB:6bq1B	0.202	0.158	2.198E-8	728	0.127	0.088	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
16	PDB:7qe7Y	0.213	0.213	8.021E-8	502	0.101	0.102	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:7kw7E	0.220	0.330	1.625E-7	327	0.103	0.159	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
18	PDB:4horA	0.196	0.204	1.977E-7	482	0.123	0.129	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
19	PDB:5dseA	0.223	0.210	2.224E-7	537	0.133	0.125	5dseA.pdb.gz
20	PDB:6yj6A	0.200	0.130	2.313E-7	819	0.147	0.090	6yj6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13217	0.0	1041	504	1.000	1.000	DNJC3_HUMAN DnaJ homolog subfamily C member 3 OS=Homo sapiens OX=9606 GN=DNAJC3 PE=1 SV=1
2	Q27968	0.0	989	504	0.962	0.962	DNJC3_BOVIN DnaJ homolog subfamily C member 3 OS=Bos taurus OX=9913 GN=DNAJC3 PE=1 SV=1
3	Q91YW3	0.0	1012	504	0.968	0.968	DNJC3_MOUSE DnaJ homolog subfamily C member 3 OS=Mus musculus OX=10090 GN=Dnajc3 PE=1 SV=1
4	Q9R0T3	0.0	973	504	0.944	0.944	DNJC3_RAT DnaJ homolog subfamily C member 3 OS=Rattus norvegicus OX=10116 GN=Dnajc3 PE=1 SV=3
5	Q9VHA8	4.36e-138	409	498	0.419	0.424	Q9VHA8_DROME LD25575p OS=Drosophila melanogaster OX=7227 GN=P58IPK PE=1 SV=1
6	P91189	2.39e-131	392	491	0.433	0.444	P91189_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-7 PE=1 SV=1
7	A0A0P0VG31	8.37e-51	182	476	0.250	0.265	DJC16_ORYSJ DnaJ protein P58IPK homolog A OS=Oryza sativa subsp. japonica OX=39947 GN=P58A PE=1 SV=1
8	Q5JNB5	8.74e-51	182	471	0.254	0.272	DJC15_ORYSJ DnaJ protein P58IPK homolog B OS=Oryza sativa subsp. japonica OX=39947 GN=P58B PE=1 SV=1
9	Q9LYW9	5.09e-44	164	482	0.262	0.274	DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana OX=3702 GN=P58IPK PE=1 SV=1
10	Q9HGM9	1.24e-39	151	476	0.258	0.273	DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1
11	A0A6I8PUD4	2.28e-38	148	481	0.258	0.270	A0A6I8PUD4_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
12	Q54IP0	1.22e-36	144	539	0.232	0.217	DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum OX=44689 GN=dnajc7 PE=1 SV=1
13	Q99615	1.49e-36	143	494	0.254	0.259	DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
14	A0A6I8PS32	1.43e-35	140	467	0.240	0.259	A0A6I8PS32_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
15	A0A6I8PU73	2.93e-35	139	497	0.252	0.256	A0A6I8PU73_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
16	A0A6I8PRZ0	3.47e-34	135	436	0.238	0.275	A0A6I8PRZ0_HUMAN DnaJ heat shock protein family (Hsp40) member C7 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=1
17	K7ER44	2.17e-27	115	401	0.230	0.289	K7ER44_HUMAN DnaJ heat shock protein family (Hsp40) member C7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2
18	Q38BB1	1.27e-22	103	499	0.236	0.238	Q38BB1_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2300 PE=4 SV=1
19	Q584G5	1.40e-18	91.3	705	0.127	0.091	Q584G5_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.310 PE=4 SV=1
20	O96123	2.69e-15	80.1	421	0.101	0.121	O96123_PLAF7 Knob associated heat shock protein 40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201800 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14863 Alkyl_sulf_dimr	18	17.1	Alkyl sulfatase dimerisation
2	PF12895 ANAPC3	0.00015	33.3	Anaphase-promoting complex, cyclosome, subunit 3
3	PF00226 DnaJ	5.1e-19	79.5	DnaJ domain
4	PF14853 Fis1_TPR_C	2.6e+02	13.2	Fis1 C-terminal tetratricopeptide repeat
5	PF10200 Ndufs5	3.9e+02	12.7	NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
6	PF00697 PRAI	4.9	18.3	N-(5'phosphoribosyl)anthranilate (PRA) isomerase
7	PF20308 TPR-S	24	16.9	Tetratricopeptide Repeats-Sensor
8	PF00515 TPR_1	3.8e-25	97.8	Tetratricopeptide repeat
9	PF13374 TPR_10	63	14.8	Tetratricopeptide repeat
10	PF13414 TPR_11	1.1e-12	58.7	TPR repeat
11	PF13424 TPR_12	1.6e-08	46.0	Tetratricopeptide repeat
12	PF13428 TPR_14	2.6e-13	60.5	Tetratricopeptide repeat
13	PF13432 TPR_16	1.7e-17	75.0	Tetratricopeptide repeat
14	PF13431 TPR_17	1.6e-07	42.3	Tetratricopeptide repeat
15	PF14559 TPR_19	2.7e-22	90.3	Tetratricopeptide repeat
16	PF07719 TPR_2	6.8e-23	89.9	Tetratricopeptide repeat
17	PF14561 TPR_20	0.00039	32.0	Tetratricopeptide repeat
18	PF09976 TPR_21	0.0015	29.8	Tetratricopeptide repeat-like domain
19	PF13174 TPR_6	0.0073	28.0	Tetratricopeptide repeat
20	PF13176 TPR_7	0.017	26.2	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000473631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302961	0.992	Heat shock protein family A member 4
2	9606.ENSP00000216037	0.986	X-box-binding protein 1
3	9606.ENSP00000324173	0.985	78 kDa glucose-regulated protein
4	9606.ENSP00000233057	0.984	Interferon-induced, double-stranded RNA-activated protein kinase
5	9606.ENSP00000385385	0.978	Protein disulfide-isomerase A6
6	9606.ENSP00000480150	0.964	Hypoxia up-regulated protein 1
7	9606.ENSP00000299767	0.958	Endoplasmin
8	9606.ENSP00000286091	0.945	Protein disulfide-isomerase A4
9	9606.ENSP00000414398	0.944	DnaJ homolog subfamily B member 11
10	9606.ENSP00000254322	0.928	DnaJ homolog subfamily B member 1
11	9606.ENSP00000432799	0.904	Mesencephalic astrocyte-derived neurotrophic factor
12	9606.ENSP00000357998	0.886	Translocation protein SEC63 homolog
13	9606.ENSP00000432083	0.879	Heat shock cognate 71 kDa protein
14	9606.ENSP00000307235	0.857	Eukaryotic translation initiation factor 2-alpha kinase 3
15	9606.ENSP00000297185	0.852	Stress-70 protein, mitochondrial
16	9606.ENSP00000327801	0.839	Protein disulfide-isomerase
17	9606.ENSP00000376587	0.831	Acetyl-coenzyme A transporter 1
18	9606.ENSP00000264065	0.822	DnaJ homolog subfamily C member 10
19	9606.ENSP00000243253	0.808	Protein transport protein Sec61 subunit alpha isoform 1
20	9606.ENSP00000264954	0.805	GrpE protein homolog 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004860	1.000	protein kinase inhibitor activity
GO:0005515	0.997	protein binding
GO:0051087	0.326	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0051246	0.993	regulation of protein metabolic process
GO:0042326	0.975	negative regulation of phosphorylation
GO:0001933	0.973	negative regulation of protein phosphorylation
GO:0009987	0.877	cellular process
GO:0050896	0.738	response to stimulus
GO:0008152	0.590	metabolic process
GO:0010468	0.576	regulation of gene expression
GO:0071704	0.566	organic substance metabolic process
GO:0044238	0.547	primary metabolic process
GO:0006807	0.528	nitrogen compound metabolic process
GO:0009889	0.507	regulation of biosynthetic process
GO:0031326	0.497	regulation of cellular biosynthetic process
GO:1901564	0.490	organonitrogen compound metabolic process
GO:0010556	0.467	regulation of macromolecule biosynthetic process
GO:0006950	0.457	response to stress
GO:0051716	0.448	cellular response to stimulus
GO:0033554	0.417	cellular response to stress
GO:0042221	0.410	response to chemical
GO:0048518	0.397	positive regulation of biological process
GO:0034976	0.395	response to endoplasmic reticulum stress
GO:0010033	0.387	response to organic substance
GO:0048522	0.365	positive regulation of cellular process
GO:0043170	0.361	macromolecule metabolic process
GO:0044237	0.341	cellular metabolic process
GO:0019538	0.331	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0070013	0.997	intracellular organelle lumen
GO:0005788	0.983	endoplasmic reticulum lumen
GO:0005829	0.930	cytosol
GO:0016020	0.785	membrane
GO:0031981	0.388	nuclear lumen
GO:0005576	0.372	extracellular region
GO:0005615	0.349	extracellular space
GO:0005654	0.336	nucleoplasm
GO:0070062	0.316	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]