StarFunc result for job id Q13219

User Input

>input (1627 residues)
MRLWSWVLHLGLLSAALGCGLAERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPP
PPPPPGGAWEAVRVPRRRQQREARGATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFT
LQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRAR
QVTTINAHRSYLPGQWVYLAATYDGQFMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLML
GGSALNHNYRGYIEHFSLWKVARTQREILSDMETHGAHTALPQLLLQENWDNVKHAWSPM
KDGSSPKVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQPKVVRYRVVNL
YEDDHKNPTVTREQVDFQHHQLAEAFKQYNISWELDVLEVSNSSLRRRLILANCDISKIG
DENCDPECNHTLTGHDGGDCRHLRHPAFVKKQHNGVCDMDCNYERFNFDGGECCDPEITN
VTQTCFDPDSPHRAYLDVNELKNILKLDGSTHLNIFFAKSSEEELAGVATWPWDKEALMH
LGGIVLNPSFYGMPGHTHTMIHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLC
NDTNPAPKHKSCGDPGPGNDTCGFHSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLD
LVYQGWQPSRKPAPVALAPQVLGHTTDSVTLEWFPPIDGHFFERELGSACHLCLEGRILV
QYASNASSPMPCSPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQG
CYLELEFLYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLAVSGKNISLGPQNVFCDVPLT
IRLWDVGEEVYGIQIYTLDEHLEIDAAMLTSTADTPLCLQCKPLKYKVVRDPPLQMDVAS
ILHLNRKFVDMDLNLGSVYQYWVITISGTEESEPSPAVTYIHGSGYCGDGIIQKDQGEQC
DDMNKINGDGCSLFCRQEVSFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFL
DQWASNASVSHQDQQCPGWVIIGQPAASQVCRTKVIDLSEGISQHAWYPCTISYPYSQLA
QTTFWLRAYFSQPMVAAAVIVHLVTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCR
NNPLIIPVVHDLSQPFYHSQAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSP
AEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQ
TGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQL
KGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPG
YHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRI
KCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGS
ECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEP
FMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKD
LRGYSHG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ufgA	0.611	0.859	0.000	1151	0.705	0.997	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
2	PDB:7ufgB	0.637	0.873	0.000	1182	0.723	0.996	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
3	PDB:8a7eC	0.566	0.603	0.000	1524	0.935	0.998	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
4	AFDB:A0A096MJG5	0.789	0.850	0.000	1502	0.825	0.894	A0A096MJG5.pdb.gz	A0A096MJG5_RAT Pappalysin 1 OS=Rattus norvegicus OX=10116 GN=Pappa PE=3 SV=1
5	AFDB:A0A0G2KQH4	0.874	0.874	0.000	1627	0.577	0.577	A0A0G2KQH4.pdb.gz
6	AFDB:E9PZ87	0.831	0.759	0.000	1789	0.449	0.408	E9PZ87.pdb.gz	E9PZ87_MOUSE Pappalysin 2 OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=1
7	AFDB:E9QCK7	0.781	0.738	0.000	1731	0.430	0.404	E9QCK7.pdb.gz	E9QCK7_DANRE Papp-a2 (Fragment) OS=Danio rerio OX=7955 GN=papp-a2 PE=3 SV=1
8	AFDB:F1Q5Q4	0.909	0.910	0.000	1624	0.595	0.596	F1Q5Q4.pdb.gz
9	AFDB:Q13219	1.000	1.000	0.000	1627	1.000	1.000	Q13219.pdb.gz	PAPP1_HUMAN Pappalysin-1 OS=Homo sapiens OX=9606 GN=PAPPA PE=1 SV=3
10	AFDB:Q9BXP8	0.833	0.761	0.000	1791	0.446	0.405	Q9BXP8.pdb.gz	PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens OX=9606 GN=PAPPA2 PE=1 SV=4
11	PDB:8a7dQ	0.155	0.785	3.522E-43	273	0.167	0.996	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
12	PDB:2gsxA	0.053	0.081	4.570E-14	951	0.086	0.147	2gsxA.pdb.gz
13	PDB:2q7zA	0.078	0.069	7.862E-13	1931	0.070	0.059	2q7zA.pdb.gz
14	PDB:1c1zA	0.096	0.291	1.061E-12	326	0.036	0.181	1c1zA.pdb.gz
15	AFDB:P08174	0.079	0.248	3.403E-11	381	0.035	0.150	P08174.pdb.gz	DAF_HUMAN Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4
16	PDB:1haqA	0.103	0.131	4.030E-10	1213	0.041	0.055	1haqA.pdb.gz
17	PDB:7zl1A	0.100	0.649	4.857E-8	215	0.023	0.177	7zl1A.pdb.gz
18	PDB:2a3wA	0.096	0.649	7.240E-8	204	0.021	0.167	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
19	AFDB:P58400	0.087	0.276	9.396E-6	472	0.028	0.097	P58400.pdb.gz	NRX1B_HUMAN Neurexin-1-beta OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=3
20	AFDB:A0A024R693	0.072	0.337	2.308E-5	250	0.022	0.144	A0A024R693.pdb.gz	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MJG5	0.0	2838	1502	0.826	0.895	A0A096MJG5_RAT Pappalysin 1 OS=Rattus norvegicus OX=10116 GN=Pappa PE=3 SV=1
2	A0A096MK86	0.0	2902	1623	0.875	0.877	A0A096MK86_RAT Pappalysin 1 OS=Rattus norvegicus OX=10116 GN=Pappa PE=3 SV=2
3	A0A0G2JU68	0.0	1433	1788	0.450	0.409	A0A0G2JU68_RAT Pappalysin 2 OS=Rattus norvegicus OX=10116 GN=Pappa2 PE=3 SV=2
4	E9PZ87	0.0	1435	1789	0.443	0.403	E9PZ87_MOUSE Pappalysin 2 OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=1
5	E9QCK7	0.0	1408	1731	0.427	0.401	E9QCK7_DANRE Papp-a2 (Fragment) OS=Danio rerio OX=7955 GN=papp-a2 PE=3 SV=1
6	M1WXG8	0.0	2004	1624	0.592	0.593	M1WXG8_DANRE Pregnancy-associated plasma protein A, pappalysin 1b precursor OS=Danio rerio OX=7955 GN=papp-ab PE=2 SV=1
7	M1XYM1	0.0	1935	1629	0.590	0.589	M1XYM1_DANRE Pappalysin-1 precursor OS=Danio rerio OX=7955 GN=papp-aa PE=2 SV=1
8	Q13219	0.0	3396	1627	1.000	1.000	PAPP1_HUMAN Pappalysin-1 OS=Homo sapiens OX=9606 GN=PAPPA PE=1 SV=3
9	Q8BJG6	0.0	1055	1214	0.324	0.434	Q8BJG6_MOUSE Pappalysin 2 (Fragment) OS=Mus musculus OX=10090 GN=Pappa2 PE=2 SV=1
10	Q8R4K8	0.0	3041	1624	0.913	0.914	PAPP1_MOUSE Pappalysin-1 OS=Mus musculus OX=10090 GN=Pappa PE=2 SV=2
11	Q9BXP8	0.0	1432	1791	0.437	0.397	PAPP2_HUMAN Pappalysin-2 OS=Homo sapiens OX=9606 GN=PAPPA2 PE=1 SV=4
12	Q505G3	8.34e-119	384	448	0.129	0.469	Q505G3_MOUSE Pappa2 protein OS=Mus musculus OX=10090 GN=Pappa2 PE=2 SV=1
13	F6TFC9	5.86e-48	174	246	0.061	0.407	F6TFC9_MOUSE Pappalysin 2 (Fragment) OS=Mus musculus OX=10090 GN=Pappa2 PE=1 SV=2
14	A0A1D5NSM8	5.51e-13	77.0	3615	0.053	0.024	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
15	Q923L3	2.08e-12	75.1	3564	0.047	0.021	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
16	P98106	2.10e-12	74.7	768	0.058	0.122	LYAM3_RAT P-selectin OS=Rattus norvegicus OX=10116 GN=Selp PE=2 SV=1
17	P16109	1.34e-11	72.0	830	0.044	0.087	LYAM3_HUMAN P-selectin OS=Homo sapiens OX=9606 GN=SELP PE=1 SV=3
18	Q61475	1.42e-11	70.9	390	0.037	0.156	DAF1_MOUSE Complement decay-accelerating factor, GPI-anchored OS=Mus musculus OX=10090 GN=Cd55 PE=1 SV=2
19	Q96PZ7	1.47e-11	72.4	3564	0.055	0.025	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
20	A2AVA0	1.47e-10	69.3	3567	0.062	0.028	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13948 DUF4215	0.39	22.5	Domain of unknown function (DUF4215)
2	PF16313 DUF4953	8.9e+02	10.4	Met-zincin
3	PF13385 Laminin_G_3	2.9e-16	71.4	Concanavalin A-like lectin/glucanases superfamily
4	PF00066 Notch	13	17.7	LNR domain
5	PF00413 Peptidase_M10	4.3e+02	12.1	Matrixin
6	PF05572 Peptidase_M43	0.00031	32.1	Pregnancy-associated plasma protein-A
7	PF13582 Reprolysin_3	1.2e+02	14.6	Metallo-peptidase family M12B Reprolysin-like
8	PF13583 Reprolysin_4	5.5e+02	11.6	Metallo-peptidase family M12B Reprolysin-like
9	PF00084 Sushi	5.3e-19	79.8	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312134	0.996	Bone marrow proteoglycan
2	9606.ENSP00000269593	0.991	Insulin-like growth factor-binding protein 4
3	9606.ENSP00000233813	0.967	Insulin-like growth factor-binding protein 5
4	9606.ENSP00000302665	0.966	Insulin-like growth factor I
5	9606.ENSP00000391826	0.964	Insulin-like growth factor II
6	9606.ENSP00000416683	0.916	Insulin-like growth factor-binding protein complex acid labile subunit
7	9606.ENSP00000265087	0.862	Stanniocalcin-2
8	9606.ENSP00000221797	0.827	Galactoside-binding soluble lectin 13
9	9606.ENSP00000451040	0.803	Placenta growth factor
10	9606.ENSP00000379138	0.758	Alpha-fetoprotein
11	9606.ENSP00000357668	0.731	Disintegrin and metalloproteinase domain-containing protein 12
12	9606.ENSP00000463154	0.690	Acidic leucine-rich nuclear phosphoprotein 32 family member E
13	9606.ENSP00000316416	0.681	Chorionic somatomammotropin hormone 1
14	9606.ENSP00000341838	0.678	Troponin I, cardiac muscle
15	9606.ENSP00000417864	0.674	Acidic leucine-rich nuclear phosphoprotein 32 family member A
16	9606.ENSP00000376623	0.654	Chorionic somatomammotropin hormone 2
17	9606.ENSP00000290271	0.649	Stanniocalcin-1
18	9606.ENSP00000400010	0.642	Receptor-type tyrosine-protein phosphatase eta
19	9606.ENSP00000404705	0.641	Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
20	9606.ENSP00000370473	0.640	Insulin-like growth factor-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	1.000	endopeptidase activity
GO:0005515	0.997	protein binding
GO:0004222	0.973	metalloendopeptidase activity
GO:0008270	0.964	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.987	multicellular organismal process
GO:0008152	0.957	metabolic process
GO:0071704	0.940	organic substance metabolic process
GO:0044238	0.906	primary metabolic process
GO:0006807	0.891	nitrogen compound metabolic process
GO:1901564	0.876	organonitrogen compound metabolic process
GO:0043170	0.873	macromolecule metabolic process
GO:0050896	0.832	response to stimulus
GO:0007565	0.824	female pregnancy
GO:0019538	0.818	protein metabolic process
GO:0009987	0.725	cellular process
GO:0065007	0.627	biological regulation
GO:0050794	0.618	regulation of cellular process
GO:0032502	0.328	developmental process
GO:0048856	0.318	anatomical structure development
GO:0042221	0.311	response to chemical
GO:0051716	0.305	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.920	extracellular space
GO:0043226	0.681	organelle
GO:0043227	0.666	membrane-bounded organelle
GO:0005622	0.368	intracellular anatomical structure
GO:0043229	0.357	intracellular organelle
GO:0043231	0.325	intracellular membrane-bounded organelle
GO:0005737	0.313	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.973	Metalloendopeptidases.

[back to server]