StarFunc result for job id Q13227

User Input

>input (327 residues)
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERM
SLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSL
TVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQF
QGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQ
TGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGK
SGFAATSQPGPRLPFIQHSQNPRFYHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13227	1.000	1.000	3.780E-47	327	1.000	1.000	Q13227.pdb.gz	GPS2_HUMAN G protein pathway suppressor 2 OS=Homo sapiens OX=9606 GN=GPS2 PE=1 SV=3
2	AFDB:Q967R6	0.334	0.167	7.671E-4	687	0.174	0.083	Q967R6.pdb.gz	CPEB_APLCA Cytoplasmic polyadenylation element-binding protein OS=Aplysia californica OX=6500 PE=1 SV=1
3	AFDB:Q9C5J5	0.203	0.208	4.292E-2	319	0.107	0.110	Q9C5J5.pdb.gz	Q9C5J5_ARATH Uncharacterized protein At1g19010 OS=Arabidopsis thaliana OX=3702 GN=At1g19010 PE=1 SV=1
4	AFDB:Q03173	0.188	0.080	9.044E-2	802	0.199	0.081	Q03173.pdb.gz	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
5	AFDB:Q6NRG6	0.207	0.114	1.218E-1	668	0.205	0.100	Q6NRG6.pdb.gz	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1
6	AFDB:Q80UK7	0.244	0.141	1.414E-1	654	0.147	0.073	Q80UK7.pdb.gz	SAS6_MOUSE Spindle assembly abnormal protein 6 homolog OS=Mus musculus OX=10090 GN=Sass6 PE=2 SV=2
7	AFDB:E9PMQ6	0.234	0.158	1.642E-1	495	0.131	0.087	E9PMQ6.pdb.gz	E9PMQ6_HUMAN Heat shock transcription factor 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=2
8	AFDB:P45970	0.190	0.081	1.769E-1	821	0.125	0.050	P45970.pdb.gz	LIN5_CAEEL Spindle apparatus protein lin-5 OS=Caenorhabditis elegans OX=6239 GN=lin-5 PE=1 SV=2
9	AFDB:A0A0G2K7W4	0.319	0.092	2.053E-1	1348	0.193	0.047	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
10	AFDB:Q7SXL7	0.177	0.139	2.212E-1	423	0.153	0.118	Q7SXL7.pdb.gz	FL2D_DANRE Pre-mRNA-splicing regulator WTAP OS=Danio rerio OX=7955 GN=wtap PE=2 SV=1
11	PDB:4v60A	0.192	0.090	8.719	812	0.086	0.034	4v60A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13227	0.0	654	327	1.000	1.000	GPS2_HUMAN G protein pathway suppressor 2 OS=Homo sapiens OX=9606 GN=GPS2 PE=1 SV=3
2	Q921N8	0.0	639	327	0.976	0.976	GPS2_MOUSE G protein pathway suppressor 2 OS=Mus musculus OX=10090 GN=Gps2 PE=1 SV=1
3	Q8IDX6	1.32e-06	52.8	3130	0.080	0.008	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
4	C6KSX6	1.25e-05	49.3	1422	0.095	0.022	C6KSX6_PLAF7 Rhoptry protein ROP14 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0613300 PE=3 SV=1
5	Q8I4Z1	1.28e-04	46.2	1846	0.076	0.014	Q8I4Z1_PLAF7 Double C2-like domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1243900 PE=4 SV=1
6	G5EBL3	0.002	42.4	2962	0.089	0.010	SDC2_CAEEL Sex determination and dosage compensation protein sdc-2 OS=Caenorhabditis elegans OX=6239 GN=sdc-2 PE=1 SV=1
7	P33332	0.002	42.4	1336	0.089	0.022	SEC3_YEAST Exocyst complex component SEC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC3 PE=1 SV=1
8	C0H5F4	0.009	40.4	3254	0.098	0.010	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
9	Q587C6	0.016	39.7	1009	0.107	0.035	Q587C6_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.430 PE=4 SV=1
10	Q75JH9	0.041	38.1	1503	0.064	0.014	Q75JH9_DICDI Actin binding protein OS=Dictyostelium discoideum OX=44689 GN=enlA PE=4 SV=1
11	Q70IK3	0.050	37.7	669	0.080	0.039	Q70IK3_CHICK Helix-loop-helix protein E12 OS=Gallus gallus OX=9031 GN=TCF3 PE=2 SV=2
12	P89105	0.055	37.7	1077	0.086	0.026	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
13	Q90ZW4	0.091	35.8	169	0.052	0.101	Q90ZW4_DANRE CCAAT/enhancer binding protein (C/EBP) 1 OS=Danio rerio OX=7955 GN=c/ebp1 PE=2 SV=1
14	P25386	0.12	37.0	1790	0.076	0.014	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
15	Q8I5T5	0.15	36.6	2961	0.064	0.007	Q8I5T5_PLAF7 Lysine-specific histone demethylase 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211600 PE=4 SV=1
16	A0A8I6AP89	0.22	35.8	686	0.080	0.038	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
17	A0A8I6AL48	0.25	35.8	684	0.080	0.038	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
18	A0A8I6GCQ1	0.27	35.4	674	0.080	0.039	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
19	A0A0G2JUD6	0.28	35.4	701	0.080	0.037	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
20	F1LQZ3	0.29	35.4	726	0.080	0.036	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15991 G_path_suppress	1.2e-82	289.8	G-protein pathway suppressor
2	PF06391 MAT1	1.1e+02	14.1	CDK-activating kinase assembly factor MAT1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011414

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010715	0.972	Transducin (beta)-like 1X-linked
2	61853.ENSNLEP00000017988	0.963	Nuclear receptor corepressor 1
3	61853.ENSNLEP00000011707	0.948	Histone deacetylase 3
4	61853.ENSNLEP00000006837	0.934	Transducin (beta)-like 1 X-linked receptor 1
5	61853.ENSNLEP00000002872	0.922	Nuclear receptor corepressor 2
6	61853.ENSNLEP00000020375	0.722	WD repeat domain 17
7	61853.ENSNLEP00000021009	0.722	WD repeat domain 38
8	61853.ENSNLEP00000011440	0.713	Nuclear receptor subfamily 0, group B, member 2
9	61853.ENSNLEP00000017015	0.697	G protein pathway suppressor 1
10	61853.ENSNLEP00000003167	0.693	Histone deacetylase 1
11	61853.ENSNLEP00000015855	0.693	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
12	61853.ENSNLEP00000022185	0.640	Belongs to the histone H2B family.
13	61853.ENSNLEP00000003353	0.637	Protein interacting with cyclin A1
14	61853.ENSNLEP00000014648	0.637	Peter pan homolog (Drosophila)
15	61853.ENSNLEP00000001151	0.635	Nuclear receptor coactivator 1
16	61853.ENSNLEP00000011912	0.628	CREB binding protein
17	61853.ENSNLEP00000018748	0.624	E1A binding protein p300
18	61853.ENSNLEP00000022018	0.623	Histone deacetylase 8
19	61853.ENSNLEP00000007412	0.622	Nuclear receptor subfamily 1, group H, member 4
20	61853.ENSNLEP00000020959	0.610	ATP-binding cassette, sub-family A (ABC1), member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003714	1.000	transcription corepressor activity
GO:0003713	1.000	transcription coactivator activity
GO:0098772	0.884	molecular function regulator activity
GO:0030332	0.861	cyclin binding
GO:0030695	0.847	GTPase regulator activity
GO:0140678	0.845	molecular function inhibitor activity
GO:0004857	0.793	enzyme inhibitor activity
GO:0005095	0.659	GTPase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0009987	0.987	cellular process
GO:0080090	0.983	regulation of primary metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0009890	0.970	negative regulation of biosynthetic process
GO:0009966	0.968	regulation of signal transduction
GO:0031324	0.968	negative regulation of cellular metabolic process
GO:0006357	0.966	regulation of transcription by RNA polymerase II
GO:0051172	0.965	negative regulation of nitrogen compound metabolic process
GO:0051173	0.958	positive regulation of nitrogen compound metabolic process
GO:0000122	0.956	negative regulation of transcription by RNA polymerase II
GO:0080134	0.955	regulation of response to stress
GO:0031325	0.955	positive regulation of cellular metabolic process
GO:0045944	0.953	positive regulation of transcription by RNA polymerase II
GO:0051716	0.952	cellular response to stimulus
GO:0006950	0.941	response to stress
GO:0010648	0.925	negative regulation of cell communication
GO:0048585	0.922	negative regulation of response to stimulus
GO:1902531	0.922	regulation of intracellular signal transduction
GO:0009968	0.899	negative regulation of signal transduction
GO:0046329	0.851	negative regulation of JNK cascade
GO:0033554	0.741	cellular response to stress
GO:0007154	0.724	cell communication
GO:0007165	0.692	signal transduction
GO:0008152	0.666	metabolic process
GO:0071704	0.613	organic substance metabolic process
GO:0044238	0.598	primary metabolic process
GO:0051246	0.464	regulation of protein metabolic process
GO:0048584	0.444	positive regulation of response to stimulus
GO:0006807	0.414	nitrogen compound metabolic process
GO:0050793	0.392	regulation of developmental process
GO:0045595	0.360	regulation of cell differentiation
GO:0032879	0.353	regulation of localization
GO:0043170	0.350	macromolecule metabolic process
GO:0032501	0.333	multicellular organismal process
GO:0002376	0.323	immune system process
GO:0009967	0.319	positive regulation of signal transduction
GO:0002682	0.318	regulation of immune system process
GO:0031399	0.318	regulation of protein modification process
GO:0035556	0.316	intracellular signal transduction
GO:1905952	0.312	regulation of lipid localization
GO:1901564	0.302	organonitrogen compound metabolic process
GO:0050776	0.300	regulation of immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0017053	0.997	transcription repressor complex
GO:0005739	0.997	mitochondrion
GO:0005829	0.996	cytosol
GO:0043232	0.894	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]