StarFunc result for job id Q13231

User Input

>input (466 residues)
MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAG
MTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFV
NSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLL
SAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAAS
LNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGM
LAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWAL
DLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC
QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13231	1.000	1.000	0.000	466	1.000	1.000	Q13231.pdb.gz	CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
2	PDB:1wawA	0.780	0.996	6.762E-77	365	0.781	0.997	1wawA.pdb.gz	Specificity and Affinity of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human and Bacterial Chitinases
3	AFDB:Q9BZP6	0.801	0.784	7.539E-71	476	0.515	0.504	Q9BZP6.pdb.gz	CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
4	AFDB:Q6RY07	0.819	0.807	3.896E-70	473	0.526	0.518	Q6RY07.pdb.gz	CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
5	AFDB:F1RA25	0.789	0.775	9.884E-68	475	0.472	0.463	F1RA25.pdb.gz
6	AFDB:Q9VZV2	0.780	0.362	2.493E-59	1013	0.395	0.182	Q9VZV2.pdb.gz	Q9VZV2_DROME Chitinase 7 OS=Drosophila melanogaster OX=7227 GN=Cht7 PE=2 SV=3
7	AFDB:Q91Z98	0.801	0.928	7.077E-58	402	0.380	0.440	Q91Z98.pdb.gz	CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus OX=10090 GN=Chil4 PE=1 SV=2
8	AFDB:Q11174	0.786	0.599	2.539E-57	617	0.403	0.305	Q11174.pdb.gz	CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
9	AFDB:P36222	0.800	0.971	2.868E-57	383	0.436	0.530	P36222.pdb.gz	CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens OX=9606 GN=CHI3L1 PE=1 SV=2
10	AFDB:Q9WTV1	0.794	0.968	7.590E-57	381	0.442	0.541	Q9WTV1.pdb.gz	CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3
11	AFDB:Q62010	0.780	0.506	1.093E-56	721	0.414	0.268	Q62010.pdb.gz	OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus OX=10090 GN=Ovgp1 PE=2 SV=1
12	PDB:1vf8A	0.776	0.968	2.969E-54	373	0.378	0.472	1vf8A.pdb.gz
13	PDB:4p8uA	0.754	0.960	7.462E-53	365	0.406	0.518	4p8uA.pdb.gz
14	PDB:1hjvA	0.754	0.967	4.396E-51	362	0.425	0.547	1hjvA.pdb.gz
15	PDB:3aquA	0.685	0.919	7.267E-36	344	0.268	0.363	3aquA.pdb.gz
16	PDB:1jndA	0.698	0.807	7.538E-32	400	0.236	0.275	1jndA.pdb.gz
17	PDB:1lloA	0.371	0.586	1.610E-8	273	0.101	0.172	1lloA.pdb.gz	Stereochemistry of chitin hydrolysis by a plant chitinase/lysozyme and X-ray structure of a complex with allosamidin: evidence for substrate assisted catalysis.
18	PDB:1om0A	0.370	0.590	1.285E-6	274	0.097	0.164	1om0A.pdb.gz
19	PDB:6mdsA	0.435	0.274	7.060E-6	787	0.114	0.067	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
20	PDB:3thcA	0.384	0.308	6.309E-5	605	0.084	0.064	3thcA.pdb.gz	Crystal structure of human beta-galactosidase: structural basis of Gm1 gangliosidosis and morquio B diseases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13231	0.0	971	466	1.000	1.000	CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
2	Q6RY07	0.0	523	473	0.534	0.526	CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
3	Q9BZP6	3.31e-179	511	476	0.528	0.517	CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens OX=9606 GN=CHIA PE=1 SV=1
4	Q91XA9	6.18e-175	501	473	0.513	0.505	CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
5	Q7SYA8	4.56e-156	453	475	0.470	0.461	Q7SYA8_DANRE chitinase OS=Danio rerio OX=7955 GN=zgc:63792 PE=1 SV=1
6	Q15782	4.33e-147	427	390	0.431	0.515	CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens OX=9606 GN=CHI3L2 PE=1 SV=1
7	Q9WTV1	1.40e-146	425	381	0.442	0.541	CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chi3l1 PE=2 SV=3
8	P36222	1.20e-142	415	383	0.433	0.527	CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens OX=9606 GN=CHI3L1 PE=1 SV=2
9	Q61362	5.82e-135	396	389	0.416	0.499	CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus OX=10090 GN=Chi3l1 PE=1 SV=3
10	Q91Z98	4.34e-132	389	402	0.388	0.450	CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus OX=10090 GN=Chil4 PE=1 SV=2
11	O35744	8.87e-132	388	398	0.391	0.457	CHIL3_MOUSE Chitinase-like protein 3 OS=Mus musculus OX=10090 GN=Chil3 PE=1 SV=2
12	Q9VZV2	1.24e-125	391	1013	0.423	0.194	Q9VZV2_DROME Chitinase 7 OS=Drosophila melanogaster OX=7227 GN=Cht7 PE=2 SV=3
13	Q62010	1.18e-122	375	721	0.395	0.255	OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus OX=10090 GN=Ovgp1 PE=2 SV=1
14	Q12889	1.44e-118	363	678	0.395	0.271	OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens OX=9606 GN=OVGP1 PE=2 SV=1
15	Q11174	2.30e-114	351	617	0.416	0.314	CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans OX=6239 GN=cht-1 PE=1 SV=1
16	M9NG70	1.05e-105	344	1367	0.384	0.131	M9NG70_DROME Chitinase 6, isoform F OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=3 SV=1
17	M9NEC2	4.98e-105	344	1580	0.384	0.113	M9NEC2_DROME Chitinase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=1
18	A8JUP3	8.27e-105	345	2225	0.384	0.080	A8JUP3_DROME Chitinase 6, isoform H OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=2
19	M9NF05	1.05e-104	344	2574	0.384	0.070	M9NF05_DROME Chitinase 6, isoform I OS=Drosophila melanogaster OX=7227 GN=Cht6 PE=1 SV=1
20	Q9W2M7	1.96e-103	318	476	0.378	0.370	Q9W2M7_DROME Chitinase 8 OS=Drosophila melanogaster OX=7227 GN=Cht8 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01607 CBM_14	6.8e-06	37.5	Chitin binding Peritrophin-A domain
2	PF00704 Glyco_hydro_18	7.7e-100	346.2	Glycosyl hydrolases family 18
3	PF04695 Pex14_N	2.2e+02	12.9	Pex14 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356198

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261416	0.940	Beta-hexosaminidase subunit beta
2	9606.ENSP00000268097	0.935	Beta-hexosaminidase subunit alpha
3	9606.ENSP00000477639	0.915	N-acetyl-D-glucosamine kinase
4	9606.ENSP00000363397	0.910	Ceramide glucosyltransferase
5	9606.ENSP00000377303	0.902	N-acylglucosamine 2-epimerase
6	9606.ENSP00000358755	0.812	Acidic mammalian chitinase
7	9606.ENSP00000261267	0.772	Lysozyme C
8	9606.ENSP00000314508	0.772	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
9	9606.ENSP00000479955	0.753	C-C motif chemokine 18
10	9606.ENSP00000264047	0.747	High affinity choline transporter 1
11	9606.ENSP00000398722	0.738	Chitinase domain-containing protein 1
12	9606.ENSP00000269228	0.605	Niemann-Pick C1 protein
13	9606.ENSP00000365116	0.583	Chymotrypsin-C
14	9606.ENSP00000363973	0.580	Alkaline phosphatase, tissue-nonspecific isozyme
15	9606.ENSP00000377900	0.564	Lipase F, gastric type
16	9606.ENSP00000253801	0.543	Glucose-6-phosphatase
17	9606.ENSP00000387760	0.537	Angiotensin-converting enzyme
18	9606.ENSP00000305692	0.534	Lysosomal alpha-glucosidase
19	9606.ENSP00000290866	0.532	Angiotensin-converting enzyme
20	9606.ENSP00000451112	0.517	Epididymal secretory protein E1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004568	1.000	chitinase activity
GO:0008061	0.998	chitin binding
GO:0005515	0.688	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0032501	0.980	multicellular organismal process
GO:1901136	0.969	carbohydrate derivative catabolic process
GO:0046348	0.962	amino sugar catabolic process
GO:0006022	0.959	aminoglycan metabolic process
GO:1901071	0.958	glucosamine-containing compound metabolic process
GO:1901565	0.943	organonitrogen compound catabolic process
GO:0006026	0.934	aminoglycan catabolic process
GO:1901072	0.932	glucosamine-containing compound catabolic process
GO:0006030	0.932	chitin metabolic process
GO:0050896	0.912	response to stimulus
GO:0007586	0.711	digestion
GO:0065007	0.549	biological regulation
GO:0044238	0.437	primary metabolic process
GO:0009605	0.436	response to external stimulus
GO:0009987	0.400	cellular process
GO:0050789	0.394	regulation of biological process
GO:0044419	0.345	biological process involved in interspecies interaction between organisms
GO:0051707	0.322	response to other organism
GO:0050794	0.314	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005615	0.997	extracellular space
GO:0043227	0.995	membrane-bounded organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0012505	0.978	endomembrane system
GO:0031982	0.961	vesicle
GO:0070013	0.946	intracellular organelle lumen
GO:0030141	0.946	secretory granule
GO:0031983	0.785	vesicle lumen
GO:0016020	0.783	membrane
GO:0034774	0.748	secretory granule lumen
GO:0070062	0.632	extracellular exosome
GO:0042581	0.572	specific granule
GO:0005764	0.404	lysosome
GO:0035580	0.404	specific granule lumen
GO:0070820	0.373	tertiary granule
GO:0031981	0.316	nuclear lumen
GO:0005775	0.310	vacuolar lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.14	1.000	chitinase.

[back to server]