StarFunc result for job id Q13232

User Input

>input (169 residues)
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQA
SEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGT
IRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13232	1.000	1.000	4.210E-35	169	1.000	1.000	Q13232.pdb.gz	NDK3_HUMAN Nucleoside diphosphate kinase 3 OS=Homo sapiens OX=9606 GN=NME3 PE=1 SV=2
2	AFDB:Q9WV85	0.950	0.950	6.432E-31	169	0.888	0.888	Q9WV85.pdb.gz	NDK3_MOUSE Nucleoside diphosphate kinase 3 OS=Mus musculus OX=10090 GN=Nme3 PE=1 SV=3
3	PDB:1zs6A	0.895	0.995	3.978E-29	152	0.899	1.000	1zs6A.pdb.gz	Structure of human nucleoside-diphosphate kinase 3
4	AFDB:A0A0R4IS05	0.952	0.895	1.076E-25	180	0.680	0.639	A0A0R4IS05.pdb.gz
5	AFDB:F1RBS6	0.886	0.978	2.701E-25	153	0.592	0.654	F1RBS6.pdb.gz
6	AFDB:P15531	0.883	0.982	2.701E-25	152	0.592	0.658	P15531.pdb.gz	NDKA_HUMAN Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1
7	AFDB:Q7SXL4	0.889	0.982	6.376E-25	153	0.544	0.601	Q7SXL4.pdb.gz	Q7SXL4_DANRE Nucleoside diphosphate kinase OS=Danio rerio OX=7955 GN=ndpkz2 PE=1 SV=1
8	AFDB:P08879	0.880	0.971	6.780E-25	153	0.592	0.654	P08879.pdb.gz	NDKA_DROME Nucleoside diphosphate kinase OS=Drosophila melanogaster OX=7227 GN=awd PE=1 SV=3
9	PDB:4fkxA	0.874	0.965	2.997E-24	153	0.544	0.601	4fkxA.pdb.gz	Crystal structure of nucleoside diphosphate kinase B from Trypanosoma brucei bound to CDP
10	AFDB:Q32Q12	0.884	0.513	3.343E-24	292	0.574	0.332	Q32Q12.pdb.gz	Q32Q12_HUMAN Nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME1-NME2 PE=1 SV=1
11	AFDB:P36010	0.879	0.970	3.779E-24	153	0.521	0.575	P36010.pdb.gz	NDK_YEAST Nucleoside diphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNK1 PE=1 SV=1
12	AFDB:Q381H3	0.876	0.967	1.009E-23	153	0.544	0.601	Q381H3.pdb.gz	Q381H3_TRYB2 Nucleoside diphosphate kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7800 PE=1 SV=1
13	PDB:3l7uB	0.866	0.949	1.229E-23	154	0.592	0.649	3l7uB.pdb.gz
14	PDB:7kpfA	0.880	0.977	1.229E-23	152	0.574	0.638	7kpfA.pdb.gz	A Chemical Proteomic Approach reveals the regulation of NME1/2 and cancer metastasis by Long-Chain Fatty Acyl Coenzyme A
15	PDB:3wx8A	0.881	0.972	1.478E-23	153	0.580	0.641	3wx8A.pdb.gz
16	PDB:4cp5A	0.862	0.963	7.976E-22	151	0.527	0.589	4cp5A.pdb.gz	Enzymatic Synthesis of Acyclic Nucleoside Thiophosphonate Diphosphates: Effect of the Alpha-Phosphorus Configuration on HIV-1 RT Activity.
17	PDB:1xiqA	0.856	0.969	7.724E-21	149	0.491	0.557	1xiqA.pdb.gz
18	PDB:7kpfF	0.789	0.985	1.715E-20	135	0.533	0.667	7kpfF.pdb.gz	A Chemical Proteomic Approach reveals the regulation of NME1/2 and cancer metastasis by Long-Chain Fatty Acyl Coenzyme A
19	PDB:1vyaA	0.851	0.964	1.939E-20	149	0.509	0.577	1vyaA.pdb.gz
20	PDB:1u8wA	0.848	0.959	3.368E-20	149	0.497	0.564	1u8wA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13232	1.18e-123	346	169	1.000	1.000	NDK3_HUMAN Nucleoside diphosphate kinase 3 OS=Homo sapiens OX=9606 GN=NME3 PE=1 SV=2
2	Q9WV85	9.39e-110	311	169	0.888	0.888	NDK3_MOUSE Nucleoside diphosphate kinase 3 OS=Mus musculus OX=10090 GN=Nme3 PE=1 SV=3
3	Q9PTF3	1.00e-91	266	169	0.728	0.728	Q9PTF3_DANRE Nucleoside diphosphate kinase OS=Danio rerio OX=7955 GN=ndpkz3 PE=1 SV=1
4	Q05982	2.89e-77	228	152	0.592	0.658	NDKA_RAT Nucleoside diphosphate kinase A OS=Rattus norvegicus OX=10116 GN=Nme1 PE=1 SV=1
5	P15532	2.45e-76	226	152	0.586	0.651	NDKA_MOUSE Nucleoside diphosphate kinase A OS=Mus musculus OX=10090 GN=Nme1 PE=1 SV=1
6	P15531	3.51e-76	226	152	0.592	0.658	NDKA_HUMAN Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1
7	Q9IAD3	3.75e-76	226	153	0.580	0.641	Q9IAD3_DANRE Nucleoside diphosphate kinase OS=Danio rerio OX=7955 GN=nme2b1 PE=1 SV=1
8	O57535	9.01e-76	225	153	0.592	0.654	NDK_CHICK Nucleoside diphosphate kinase OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q3T0Q4	2.36e-75	224	152	0.598	0.664	NDKB_BOVIN Nucleoside diphosphate kinase B OS=Bos taurus OX=9913 GN=NME2 PE=1 SV=1
10	P19804	1.79e-74	221	152	0.580	0.645	NDKB_RAT Nucleoside diphosphate kinase B OS=Rattus norvegicus OX=10116 GN=Nme2 PE=1 SV=1
11	Q01768	3.00e-74	221	152	0.580	0.645	NDKB_MOUSE Nucleoside diphosphate kinase B OS=Mus musculus OX=10090 GN=Nme2 PE=1 SV=1
12	P22392	5.30e-74	220	152	0.574	0.638	NDKB_HUMAN Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2 PE=1 SV=1
13	P08879	2.80e-73	218	153	0.592	0.654	NDKA_DROME Nucleoside diphosphate kinase OS=Drosophila melanogaster OX=7227 GN=awd PE=1 SV=3
14	Q32Q12	2.43e-72	221	292	0.574	0.332	Q32Q12_HUMAN Nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME1-NME2 PE=1 SV=1
15	Q7SXL4	5.13e-70	210	153	0.544	0.601	Q7SXL4_DANRE Nucleoside diphosphate kinase OS=Danio rerio OX=7955 GN=ndpkz2 PE=1 SV=1
16	Q381H3	2.60e-69	208	153	0.550	0.608	Q381H3_TRYB2 Nucleoside diphosphate kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7800 PE=1 SV=1
17	Q9U9K9	1.30e-68	207	153	0.544	0.601	Q9U9K9_9TRYP Nucleoside diphosphate kinase OS=Trypanosoma brucei OX=5691 GN=NDPK PE=3 SV=1
18	O00746	6.79e-66	201	187	0.527	0.476	NDKM_HUMAN Nucleoside diphosphate kinase, mitochondrial OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1
19	Q4TT34	7.29e-66	201	195	0.527	0.456	Q4TT34_HUMAN Nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME4 PE=1 SV=1
20	P36010	1.43e-65	199	153	0.521	0.575	NDK_YEAST Nucleoside diphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04909 Amidohydro_2	1.9e+02	13.2	Amidohydrolase
2	PF00334 NDK	3.4e-52	187.5	Nucleoside diphosphate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010686

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009443	0.989	Deoxythymidylate kinase (thymidylate kinase)
2	61853.ENSNLEP00000017317	0.987	Guanylate kinase 1
3	61853.ENSNLEP00000019867	0.987	UMP-CMP kinase
4	61853.ENSNLEP00000011604	0.985	CTP synthase
5	61853.ENSNLEP00000023879	0.985	CTP synthase
6	61853.ENSNLEP00000009673	0.962	NME/NM23 nucleoside diphosphate kinase 1
7	61853.ENSNLEP00000011761	0.962	Adenylate kinase 5
8	61853.ENSNLEP00000018716	0.962	Cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial
9	61853.ENSNLEP00000021038	0.959	Ribonucleoside-diphosphate reductase
10	61853.ENSNLEP00000004117	0.955	Ribonucleotide reductase M2 B (TP53 inducible)
11	61853.ENSNLEP00000016728	0.955	Ribonucleotide reductase M2
12	61853.ENSNLEP00000014835	0.940	HD domain containing 3
13	61853.ENSNLEP00000010830	0.929	GTP:AMP phosphotransferase AK3, mitochondrial
14	61853.ENSNLEP00000019200	0.927	Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism
15	61853.ENSNLEP00000002834	0.926	Nucleoside-triphosphatase, cancer-related
16	61853.ENSNLEP00000005991	0.921	Nudix hydrolase 2
17	61853.ENSNLEP00000015410	0.913	Adenylate kinase 9
18	61853.ENSNLEP00000016838	0.910	Pyruvate kinase, muscle
19	61853.ENSNLEP00000010853	0.907	Ectonucleoside triphosphate diphosphohydrolase 2
20	61853.ENSNLEP00000003397	0.901	Nudix hydrolase 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004550	1.000	nucleoside diphosphate kinase activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0044237	0.839	cellular metabolic process
GO:0071704	0.793	organic substance metabolic process
GO:0012501	0.689	programmed cell death
GO:0044238	0.683	primary metabolic process
GO:0006807	0.655	nitrogen compound metabolic process
GO:0006915	0.566	apoptotic process
GO:0034641	0.548	cellular nitrogen compound metabolic process
GO:0006725	0.543	cellular aromatic compound metabolic process
GO:1901360	0.538	organic cyclic compound metabolic process
GO:0046483	0.538	heterocycle metabolic process
GO:0065007	0.491	biological regulation
GO:0050789	0.474	regulation of biological process
GO:0006139	0.460	nucleobase-containing compound metabolic process
GO:0009058	0.395	biosynthetic process
GO:0050794	0.393	regulation of cellular process
GO:0044281	0.383	small molecule metabolic process
GO:1901576	0.376	organic substance biosynthetic process
GO:0044249	0.374	cellular biosynthetic process
GO:0055086	0.343	nucleobase-containing small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.982	cytosol
GO:0043226	0.975	organelle
GO:0043227	0.967	membrane-bounded organelle
GO:0043229	0.967	intracellular organelle
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0005739	0.690	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.6	1.000	nucleoside-diphosphate kinase.

[back to server]