StarFunc result for job id Q13233

User Input

>input (1512 residues)
MAAAAGNRASSSGFPGARATSPEAGGGGGALKASSAPAAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEQPLFLAASPPASSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLTESVAAPDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEVQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTVQQQPLAGSRRNQESNFN
LTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANG
ESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLRA
MLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAVG
REILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVSTD
VSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLEM
LSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASVPNNYLETTENS
SPECTVHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTTTTTTEQPKPMVQTKG
RPHSQCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQ
TQRKFSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNS
MTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASM
PSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQD
ALPIVPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQA
QDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYN
LFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDST
GQRLRIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAII
EMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSR
ELLKHPVFRTTW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P53349	0.332	0.335	0.000	1493	0.897	0.908	P53349.pdb.gz	M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map3k1 PE=1 SV=3
2	AFDB:Q13233	1.000	1.000	0.000	1512	1.000	1.000	Q13233.pdb.gz	M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP3K1 PE=1 SV=4
3	AFDB:Q10407	0.187	0.249	5.467E-19	1116	0.100	0.135	Q10407.pdb.gz	MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1
4	PDB:4zhxA	0.163	0.577	6.853E-15	409	0.044	0.164	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
5	PDB:4krcA	0.157	0.749	7.165E-15	297	0.052	0.263	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
6	PDB:4c0tA	0.163	0.778	9.788E-15	291	0.051	0.265	4c0tA.pdb.gz
7	PDB:4eomC	0.162	0.819	1.223E-14	276	0.048	0.261	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
8	PDB:5u6yA	0.159	0.497	1.462E-14	459	0.048	0.157	5u6yA.pdb.gz
9	PDB:5ufuA	0.162	0.630	1.528E-14	369	0.046	0.190	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
10	AFDB:Q03497	0.163	0.260	2.755E-14	939	0.088	0.142	Q03497.pdb.gz	STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE20 PE=1 SV=1
11	PDB:1unlA	0.155	0.738	2.982E-14	292	0.048	0.250	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
12	PDB:3c4wB	0.165	0.463	3.260E-14	519	0.053	0.154	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
13	PDB:4mk0A	0.160	0.372	4.073E-14	631	0.048	0.114	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:7myjC	0.161	0.502	4.453E-14	465	0.044	0.144	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	AFDB:P07527	0.144	0.242	7.677E-14	877	0.090	0.155	P07527.pdb.gz	WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wee1 PE=1 SV=1
16	AFDB:M9PGC5	0.163	0.102	1.370E-13	2462	0.092	0.056	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
17	AFDB:Q9C660	0.153	0.292	4.988E-13	762	0.080	0.159	Q9C660.pdb.gz	PEK10_ARATH Proline-rich receptor-like protein kinase PERK10 OS=Arabidopsis thaliana OX=3702 GN=PERK10 PE=1 SV=2
18	AFDB:F4HQ88	0.155	0.196	6.814E-13	1169	0.127	0.164	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
19	AFDB:O74526	0.161	0.299	6.415E-11	781	0.084	0.163	O74526.pdb.gz	KJ45_SCHPO Probable serine/threonine-protein kinase C70.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.05c PE=1 SV=1
20	AFDB:Q6P0Q8	0.168	0.142	7.115E-10	1798	0.085	0.071	Q6P0Q8.pdb.gz	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P53349	0.0	2498	1493	0.888	0.900	M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map3k1 PE=1 SV=3
2	Q13233	0.0	3121	1512	1.000	1.000	M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP3K1 PE=1 SV=4
3	Q62925	0.0	2506	1493	0.892	0.904	M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map3k1 PE=1 SV=1
4	Q9FZ36	2.90e-66	240	651	0.077	0.178	M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1
5	Q40541	3.93e-65	237	690	0.080	0.175	NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum OX=4097 GN=NPK1 PE=1 SV=1
6	O22040	1.46e-64	235	666	0.077	0.174	ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana OX=3702 GN=ANP1 PE=1 SV=2
7	O22042	5.30e-63	230	651	0.077	0.178	M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1
8	Q54R82	1.12e-59	225	942	0.073	0.118	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
9	X1WGZ3	2.70e-59	218	620	0.077	0.187	X1WGZ3_DANRE Mitogen-activated protein kinase kinase kinase 3 OS=Danio rerio OX=7955 GN=map3k3 PE=4 SV=1
10	Q99759	8.25e-58	214	626	0.078	0.188	M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2
11	Q61084	1.50e-57	213	626	0.077	0.187	M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1
12	F4HRJ4	1.74e-56	210	609	0.067	0.166	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
13	F1M9D0	3.14e-56	209	619	0.076	0.186	F1M9D0_RAT Mitogen activated protein kinase kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Map3k2 PE=1 SV=2
14	Q9Y2U5	7.60e-56	208	619	0.076	0.186	M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2
15	Q61083	1.50e-54	204	619	0.075	0.184	M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2
16	Q01389	1.00e-52	206	1478	0.075	0.077	BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCK1 PE=1 SV=1
17	G5EB26	1.66e-52	202	886	0.072	0.123	G5EB26_EMENI MAPKK kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02269 PE=3 SV=1
18	Q6FXI1	2.06e-52	199	676	0.069	0.155	Q6FXI1_CANGA Candida glabrata strain CBS138 chromosome B complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE11 PE=3 SV=1
19	Q9CAD5	7.14e-52	201	883	0.064	0.110	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
20	P28829	1.98e-51	196	659	0.067	0.153	BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	1.9e+02	13.3	Phosphotransferase enzyme family
2	PF16087 DUF4817	6.6e+02	11.5	Helix-turn-helix domain (DUF4817)
3	PF14531 Kinase-like	0.0014	29.7	Kinase-like
4	PF00628 PHD	68	14.8	PHD-finger
5	PF00069 Pkinase	1.9e-62	222.6	Protein kinase domain
6	PF17667 Pkinase_fungal	0.0047	27.4	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	7.4e-36	135.3	Protein tyrosine and serine/threonine kinase
8	PF12861 zf-ANAPC11	5.5e+02	12.0	Anaphase-promoting complex subunit 11 RING-H2 finger
9	PF13639 zf-RING_2	0.02	26.6	Ring finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.996	Axin-1
2	9606.ENSP00000410402	0.992	Dual specificity mitogen-activated protein kinase kinase 4
3	9606.ENSP00000378974	0.991	Mitogen-activated protein kinase 8
4	9606.ENSP00000247668	0.986	TNF receptor-associated factor 2
5	9606.ENSP00000302486	0.984	Dual specificity mitogen-activated protein kinase kinase 1
6	9606.ENSP00000454207	0.982	TNF receptor-associated factor 3
7	9606.ENSP00000381070	0.981	Dual specificity mitogen-activated protein kinase kinase 7
8	9606.ENSP00000483825	0.979	NF-kappa-B essential modulator
9	9606.ENSP00000433623	0.977	TNF receptor-associated factor 6
10	9606.ENSP00000359424	0.975	Inhibitor of nuclear factor kappa-B kinase subunit alpha
11	9606.ENSP00000430684	0.975	Inhibitor of nuclear factor kappa-B kinase subunit beta
12	9606.ENSP00000361359	0.974	Tumor necrosis factor receptor superfamily member 5
13	9606.ENSP00000216160	0.968	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
14	9606.ENSP00000162749	0.966	Tumor necrosis factor receptor superfamily member 1A
15	9606.ENSP00000383118	0.966	Cell division control protein 42 homolog
16	9606.ENSP00000270517	0.959	Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
17	9606.ENSP00000294066	0.957	Mitogen-activated protein kinase kinase kinase kinase 2
18	9606.ENSP00000407586	0.956	GTPase HRas
19	9606.ENSP00000343658	0.947	Mitogen-activated protein kinase kinase kinase kinase 4
20	9606.ENSP00000178640	0.946	Dual specificity mitogen-activated protein kinase kinase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004709	1.000	MAP kinase kinase kinase activity
GO:0019899	0.998	enzyme binding
GO:0019901	0.974	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0048518	0.990	positive regulation of biological process
GO:0051716	0.983	cellular response to stimulus
GO:0048522	0.971	positive regulation of cellular process
GO:0010646	0.950	regulation of cell communication
GO:0048584	0.946	positive regulation of response to stimulus
GO:0007154	0.937	cell communication
GO:0019222	0.936	regulation of metabolic process
GO:0031323	0.927	regulation of cellular metabolic process
GO:0007165	0.924	signal transduction
GO:0060255	0.918	regulation of macromolecule metabolic process
GO:0007166	0.912	cell surface receptor signaling pathway
GO:0023051	0.907	regulation of signaling
GO:0051171	0.893	regulation of nitrogen compound metabolic process
GO:0080090	0.890	regulation of primary metabolic process
GO:0009966	0.881	regulation of signal transduction
GO:1902531	0.866	regulation of intracellular signal transduction
GO:0009893	0.861	positive regulation of metabolic process
GO:0010604	0.843	positive regulation of macromolecule metabolic process
GO:0010647	0.814	positive regulation of cell communication
GO:0023056	0.812	positive regulation of signaling
GO:0035556	0.764	intracellular signal transduction
GO:0009967	0.731	positive regulation of signal transduction
GO:0065009	0.716	regulation of molecular function
GO:1902533	0.713	positive regulation of intracellular signal transduction
GO:0008152	0.711	metabolic process
GO:0051128	0.699	regulation of cellular component organization
GO:0071704	0.666	organic substance metabolic process
GO:0006950	0.666	response to stress
GO:0044238	0.661	primary metabolic process
GO:0044237	0.648	cellular metabolic process
GO:0031325	0.644	positive regulation of cellular metabolic process
GO:0006807	0.628	nitrogen compound metabolic process
GO:0051173	0.617	positive regulation of nitrogen compound metabolic process
GO:0043170	0.573	macromolecule metabolic process
GO:0051246	0.568	regulation of protein metabolic process
GO:1901564	0.549	organonitrogen compound metabolic process
GO:0019538	0.542	protein metabolic process
GO:0043412	0.485	macromolecule modification
GO:0036211	0.483	protein modification process
GO:0010468	0.448	regulation of gene expression
GO:0048523	0.445	negative regulation of cellular process
GO:0002682	0.426	regulation of immune system process
GO:0051247	0.399	positive regulation of protein metabolic process
GO:0051174	0.397	regulation of phosphorus metabolic process
GO:0031399	0.396	regulation of protein modification process
GO:0031401	0.391	positive regulation of protein modification process
GO:0033043	0.390	regulation of organelle organization
GO:0001932	0.386	regulation of protein phosphorylation
GO:0044093	0.385	positive regulation of molecular function
GO:0000165	0.365	MAPK cascade
GO:0050790	0.350	regulation of catalytic activity
GO:0032970	0.344	regulation of actin filament-based process
GO:0009605	0.326	response to external stimulus
GO:0006793	0.326	phosphorus metabolic process
GO:0009889	0.322	regulation of biosynthetic process
GO:0006796	0.321	phosphate-containing compound metabolic process
GO:0019219	0.312	regulation of nucleobase-containing compound metabolic process
GO:0043408	0.312	regulation of MAPK cascade
GO:0001934	0.311	positive regulation of protein phosphorylation
GO:0031326	0.308	regulation of cellular biosynthetic process
GO:0010556	0.307	regulation of macromolecule biosynthetic process
GO:0050776	0.304	regulation of immune response
GO:0045859	0.304	regulation of protein kinase activity
GO:0043085	0.302	positive regulation of catalytic activity
GO:2001141	0.301	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.995	intracellular organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0005829	0.993	cytosol
GO:0016020	0.977	membrane
GO:0043231	0.608	intracellular membrane-bounded organelle
GO:0005856	0.585	cytoskeleton
GO:0032991	0.309	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.25	1.000	mitogen-activated protein kinase kinase kinase.

[back to server]