StarFunc result for job id Q13241

User Input

>input (179 residues)
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCS
CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLS
YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13241	1.000	1.000	3.011E-34	179	1.000	1.000	Q13241.pdb.gz	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
2	AFDB:O54707	0.696	0.696	4.267E-23	179	0.542	0.542	O54707.pdb.gz	KLRD1_MOUSE Natural killer cells antigen CD94 OS=Mus musculus OX=10090 GN=Klrd1 PE=2 SV=1
3	AFDB:Q8CJC7	0.610	0.492	1.312E-13	226	0.330	0.261	Q8CJC7.pdb.gz	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
4	AFDB:O54709	0.578	0.453	2.690E-13	232	0.279	0.216	O54709.pdb.gz	NKG2D_MOUSE NKG2-D type II integral membrane protein OS=Mus musculus OX=10090 GN=Klrk1 PE=1 SV=2
5	AFDB:Q8VD98	0.639	0.536	1.004E-12	217	0.274	0.226	Q8VD98.pdb.gz	KLRBF_MOUSE Killer cell lectin-like receptor subfamily B member 1F OS=Mus musculus OX=10090 GN=Klrb1f PE=2 SV=1
6	AFDB:Q80ZC8	0.571	0.459	1.066E-12	226	0.335	0.265	Q80ZC8.pdb.gz	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
7	AFDB:A4D1U7	0.597	0.571	1.275E-12	188	0.257	0.245	A4D1U7.pdb.gz	A4D1U7_HUMAN C-type (Calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 5 OS=Homo sapiens OX=9606 GN=CLECSF5 PE=2 SV=1
8	AFDB:O70215	0.604	0.510	2.186E-12	215	0.279	0.233	O70215.pdb.gz	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
9	AFDB:Q9NZS2	0.574	0.449	3.977E-12	231	0.263	0.203	Q9NZS2.pdb.gz	KLRF1_HUMAN Killer cell lectin-like receptor subfamily F member 1 OS=Homo sapiens OX=9606 GN=KLRF1 PE=1 SV=3
10	AFDB:P27814	0.636	0.517	5.695E-12	223	0.235	0.188	P27814.pdb.gz	KLRBC_MOUSE Killer cell lectin-like receptor subfamily B member 1C OS=Mus musculus OX=10090 GN=Klrb1c PE=1 SV=2
11	PDB:7wz8A	0.560	0.557	4.353E-9	180	0.201	0.200	7wz8A.pdb.gz
12	PDB:1qddA	0.571	0.694	6.619E-9	144	0.201	0.250	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
13	PDB:7qsrA	0.537	0.079	1.624E-8	1335	0.196	0.026	7qsrA.pdb.gz
14	PDB:3bx4C	0.457	0.596	4.493E-8	134	0.196	0.261	3bx4C.pdb.gz
15	PDB:5f2qB	0.508	0.652	5.709E-8	135	0.173	0.230	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
16	PDB:4mthA	0.544	0.682	2.549E-7	139	0.162	0.209	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
17	PDB:1bj3B	0.479	0.677	3.439E-7	123	0.162	0.236	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
18	PDB:1gz2A	0.551	0.692	6.642E-7	139	0.140	0.180	1gz2A.pdb.gz
19	PDB:1htnA	0.558	0.632	7.052E-7	156	0.184	0.212	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
20	PDB:7jptA	0.552	0.085	7.052E-7	1327	0.196	0.026	7jptA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13241	3.06e-132	369	179	1.000	1.000	KLRD1_HUMAN Natural killer cells antigen CD94 OS=Homo sapiens OX=9606 GN=KLRD1 PE=1 SV=2
2	O54707	1.00e-67	206	179	0.536	0.536	KLRD1_MOUSE Natural killer cells antigen CD94 OS=Mus musculus OX=10090 GN=Klrd1 PE=2 SV=1
3	Q80ZC8	2.01e-27	104	226	0.330	0.261	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
4	Q8CJC7	2.16e-27	104	226	0.341	0.270	KLRE1_MOUSE Killer cell lectin-like receptor subfamily E member 1 OS=Mus musculus OX=10090 GN=Klre1 PE=1 SV=1
5	O54709	2.79e-21	89.0	232	0.279	0.216	NKG2D_MOUSE NKG2-D type II integral membrane protein OS=Mus musculus OX=10090 GN=Klrk1 PE=1 SV=2
6	O70215	2.36e-20	85.9	215	0.240	0.200	NKG2D_RAT NKG2-D type II integral membrane protein OS=Rattus norvegicus OX=10116 GN=Klrk1 PE=2 SV=1
7	P26715	3.03e-20	86.3	233	0.257	0.197	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
8	P26717	3.68e-20	85.9	231	0.263	0.203	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
9	Q07444	9.28e-19	82.4	240	0.291	0.217	NKG2E_HUMAN NKG2-E type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC3 PE=2 SV=3
10	P26718	1.38e-18	81.3	216	0.263	0.218	NKG2D_HUMAN NKG2-D type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRK1 PE=1 SV=2
11	Q9WTJ9	2.38e-16	75.9	238	0.285	0.214	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
12	D3YXP2	3.83e-16	75.1	221	0.279	0.226	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
13	Q9WU32	6.67e-16	74.7	227	0.285	0.225	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
14	Q9WU31	1.22e-15	73.9	244	0.291	0.213	Q9WU31_MOUSE Natural killer cell receptor NKG2A OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
15	A6H5Z4	1.56e-15	73.9	244	0.291	0.213	A6H5Z4_MOUSE Klrc1 protein OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
16	Q8CB89	2.78e-15	72.4	206	0.251	0.218	Q8CB89_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
17	Q2HXU8	3.23e-15	73.6	276	0.235	0.152	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
18	P27811	3.60e-15	72.4	227	0.257	0.203	KLRBA_MOUSE Killer cell lectin-like receptor subfamily B member 1A OS=Mus musculus OX=10090 GN=Klrb1a PE=1 SV=2
19	Q9Z202	6.07e-15	72.4	244	0.291	0.213	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
20	A1L3Q6	2.41e-14	70.5	246	0.296	0.215	A1L3Q6_MOUSE Klrc3 protein OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	54	14.5	Chordopoxvirus A33R protein
2	PF00059 Lectin_C	2.1e-12	59.0	Lectin C-type domain
3	PF08391 Ly49	8.9e+02	11.6	Ly49-like protein, N-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371333

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365817	0.999	HLA class I histocompatibility antigen, alpha chain E
2	9606.ENSP00000438038	0.997	NKG2-A/NKG2-B type II integral membrane protein
3	9606.ENSP00000452780	0.996	Beta-2-microglobulin
4	9606.ENSP00000262629	0.995	TYRO protein tyrosine kinase-binding protein
5	9606.ENSP00000371327	0.980	NKG2-C type II integral membrane protein
6	9606.ENSP00000413079	0.978	MHC class I polypeptide-related sequence A
7	9606.ENSP00000336769	0.972	Killer cell immunoglobulin-like receptor 2DL1
8	9606.ENSP00000342215	0.972	Killer cell immunoglobulin-like receptor 2DL3
9	9606.ENSP00000259951	0.970	HLA class I histocompatibility antigen, alpha chain F
10	9606.ENSP00000375608	0.970	Killer cell immunoglobulin-like receptor 3DL1
11	9606.ENSP00000379873	0.969	HLA class I histocompatibility antigen, A-3 alpha chain
12	9606.ENSP00000412927	0.968	HLA class I histocompatibility antigen, alpha chain G
13	9606.ENSP00000325525	0.949	Killer cell immunoglobulin-like receptor 3DL2
14	9606.ENSP00000291860	0.946	Killer cell immunoglobulin-like receptor 3DL3
15	9606.ENSP00000310216	0.928	NKG2-F type II integral membrane protein
16	9606.ENSP00000399168	0.927	HLA class I histocompatibility antigen, B-7 alpha chain
17	9606.ENSP00000391592	0.925	Tyrosine-protein phosphatase non-receptor type 6
18	9606.ENSP00000365402	0.924	HLA class I histocompatibility antigen, Cw-7 alpha chain
19	9606.ENSP00000340944	0.884	Tyrosine-protein phosphatase non-receptor type 11
20	9606.ENSP00000291890	0.870	Natural cytotoxicity triggering receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.998	protein-containing complex binding
GO:0140375	0.998	immune receptor activity
GO:0005102	0.998	signaling receptor binding
GO:0004888	0.998	transmembrane signaling receptor activity
GO:0003823	0.997	antigen binding
GO:0042287	0.993	MHC protein binding
GO:0023023	0.992	MHC protein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.989	regulation of response to stimulus
GO:0002682	0.989	regulation of immune system process
GO:0050776	0.982	regulation of immune response
GO:0080134	0.981	regulation of response to stress
GO:0048584	0.977	positive regulation of response to stimulus
GO:0032101	0.974	regulation of response to external stimulus
GO:0002697	0.973	regulation of immune effector process
GO:0007154	0.971	cell communication
GO:0031347	0.971	regulation of defense response
GO:0002831	0.970	regulation of response to biotic stimulus
GO:0002684	0.969	positive regulation of immune system process
GO:0002703	0.961	regulation of leukocyte mediated immunity
GO:0045088	0.958	regulation of innate immune response
GO:0001910	0.945	regulation of leukocyte mediated cytotoxicity
GO:0002715	0.945	regulation of natural killer cell mediated immunity
GO:0042269	0.943	regulation of natural killer cell mediated cytotoxicity
GO:0044419	0.935	biological process involved in interspecies interaction between organisms
GO:0051707	0.931	response to other organism
GO:0051716	0.922	cellular response to stimulus
GO:0050778	0.922	positive regulation of immune response
GO:0006950	0.918	response to stress
GO:0002376	0.908	immune system process
GO:0007165	0.903	signal transduction
GO:0048522	0.893	positive regulation of cellular process
GO:0002764	0.891	immune response-regulating signaling pathway
GO:0002699	0.889	positive regulation of immune effector process
GO:0006952	0.888	defense response
GO:0002253	0.884	activation of immune response
GO:0002833	0.883	positive regulation of response to biotic stimulus
GO:0002683	0.879	negative regulation of immune system process
GO:0032103	0.873	positive regulation of response to external stimulus
GO:0002705	0.872	positive regulation of leukocyte mediated immunity
GO:0002768	0.871	immune response-regulating cell surface receptor signaling pathway
GO:0032102	0.865	negative regulation of response to external stimulus
GO:0002252	0.860	immune effector process
GO:0002757	0.858	immune response-activating signaling pathway
GO:0045089	0.855	positive regulation of innate immune response
GO:0031348	0.833	negative regulation of defense response
GO:0002708	0.829	positive regulation of lymphocyte mediated immunity
GO:0006955	0.819	immune response
GO:0002819	0.813	regulation of adaptive immune response
GO:0048523	0.812	negative regulation of cellular process
GO:0002429	0.807	immune response-activating cell surface receptor signaling pathway
GO:0050777	0.804	negative regulation of immune response
GO:0031343	0.794	positive regulation of cell killing
GO:0001912	0.757	positive regulation of leukocyte mediated cytotoxicity
GO:0002717	0.755	positive regulation of natural killer cell mediated immunity
GO:0002698	0.723	negative regulation of immune effector process
GO:0002443	0.720	leukocyte mediated immunity
GO:0002704	0.713	negative regulation of leukocyte mediated immunity
GO:0031342	0.688	negative regulation of cell killing
GO:0045954	0.682	positive regulation of natural killer cell mediated cytotoxicity
GO:0002822	0.679	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002707	0.672	negative regulation of lymphocyte mediated immunity
GO:0045824	0.672	negative regulation of innate immune response
GO:0002218	0.658	activation of innate immune response
GO:0002758	0.642	innate immune response-activating signaling pathway
GO:0002709	0.640	regulation of T cell mediated immunity
GO:0002449	0.639	lymphocyte mediated immunity
GO:0001911	0.593	negative regulation of leukocyte mediated cytotoxicity
GO:0098542	0.586	defense response to other organism
GO:0002820	0.573	negative regulation of adaptive immune response
GO:0002220	0.552	innate immune response activating cell surface receptor signaling pathway
GO:0045087	0.344	innate immune response
GO:0032501	0.340	multicellular organismal process
GO:0001914	0.340	regulation of T cell mediated cytotoxicity
GO:0002823	0.338	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051239	0.325	regulation of multicellular organismal process
GO:0019222	0.322	regulation of metabolic process
GO:0060255	0.302	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.918	protein-containing complex
GO:0043235	0.739	receptor complex
GO:0009986	0.507	cell surface
GO:0005622	0.477	intracellular anatomical structure
GO:0043226	0.471	organelle
GO:0043227	0.449	membrane-bounded organelle
GO:0043229	0.439	intracellular organelle
GO:0005737	0.415	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]