StarFunc result for job id Q13242

User Input

>input (221 residues)
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13242	1.000	1.000	1.631E-46	221	1.000	1.000	Q13242.pdb.gz	SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1
2	AFDB:D4A9L2	0.728	0.653	1.780E-31	248	0.715	0.637	D4A9L2.pdb.gz	D4A9L2_RAT Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1
3	AFDB:Q9V3W7	0.667	0.585	2.387E-28	255	0.570	0.494	Q9V3W7.pdb.gz	Q9V3W7_DROME LD40489p OS=Drosophila melanogaster OX=7227 GN=SF2 PE=1 SV=1
4	AFDB:Q9NEW6	0.497	0.441	9.492E-28	258	0.584	0.500	Q9NEW6.pdb.gz	RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans OX=6239 GN=rsp-3 PE=1 SV=2
5	AFDB:Q9XFR5	0.585	0.495	3.531E-24	268	0.502	0.414	Q9XFR5.pdb.gz	SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana OX=3702 GN=SR30 PE=1 SV=1
6	AFDB:A2RVS6	0.575	0.440	3.981E-24	300	0.520	0.383	A2RVS6.pdb.gz	SR34A_ARATH Serine/arginine-rich splicing factor SR34A OS=Arabidopsis thaliana OX=3702 GN=SR34A PE=2 SV=1
7	AFDB:O22315	0.580	0.436	2.409E-23	303	0.507	0.370	O22315.pdb.gz	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1
8	AFDB:Q8I3T5	0.415	0.319	1.147E-22	298	0.443	0.329	Q8I3T5.pdb.gz	Q8I3T5_PLAF7 Serine/arginine-rich splicing factor 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0517300 PE=1 SV=2
9	AFDB:Q8IJI0	0.369	0.161	1.633E-19	538	0.362	0.149	Q8IJI0.pdb.gz	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
10	AFDB:P26686	0.335	0.200	5.424E-19	376	0.421	0.247	P26686.pdb.gz	SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4
11	PDB:7abgA6	0.316	0.917	1.801E-10	74	0.267	0.797	7abgA6.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:7oqcF	0.317	0.265	1.912E-10	267	0.158	0.131	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:5vsuA	0.307	0.180	6.595E-9	387	0.127	0.072	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	PDB:6y5qq	0.323	0.395	1.622E-8	178	0.149	0.185	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:6ff7X	0.323	0.410	1.407E-7	171	0.113	0.146	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:6y53o	0.338	0.451	2.142E-7	160	0.140	0.194	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
17	PDB:7evoD	0.312	0.344	3.071E-7	200	0.149	0.165	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
18	PDB:3lqvB	0.323	0.606	1.552E-6	115	0.104	0.200	3lqvB.pdb.gz	Branch Recognition by SF3b14
19	PDB:5lsbA	0.333	0.408	5.154E-6	176	0.140	0.176	5lsbA.pdb.gz
20	PDB:6r5kH	0.299	0.172	6.171E-6	394	0.154	0.086	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13242	1.17e-160	444	221	1.000	1.000	SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1
2	Q5PPI1	1.84e-156	434	221	0.973	0.973	SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus OX=10116 GN=Srsf9 PE=1 SV=1
3	A0A8I6GMR8	3.06e-80	242	253	0.606	0.530	A0A8I6GMR8_RAT Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1
4	D4A9L2	4.12e-80	241	248	0.606	0.540	D4A9L2_RAT Serine/arginine-rich splicing factor 1 OS=Rattus norvegicus OX=10116 GN=Srsf1 PE=1 SV=1
5	Q07955	4.12e-80	241	248	0.606	0.540	SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2
6	Q6PDM2	4.12e-80	241	248	0.606	0.540	SRSF1_MOUSE Serine/arginine-rich splicing factor 1 OS=Mus musculus OX=10090 GN=Srsf1 PE=1 SV=3
7	Q9V3W7	3.39e-69	214	255	0.489	0.424	Q9V3W7_DROME LD40489p OS=Drosophila melanogaster OX=7227 GN=SF2 PE=1 SV=1
8	Q9NEW6	9.67e-62	195	258	0.502	0.430	RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans OX=6239 GN=rsp-3 PE=1 SV=2
9	Q9XFR5	8.11e-56	180	268	0.471	0.388	SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana OX=3702 GN=SR30 PE=1 SV=1
10	A2RVS6	4.40e-49	164	300	0.421	0.310	SR34A_ARATH Serine/arginine-rich splicing factor SR34A OS=Arabidopsis thaliana OX=3702 GN=SR34A PE=2 SV=1
11	O22315	5.90e-49	164	303	0.425	0.310	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1
12	Q8I3T5	3.33e-44	151	298	0.389	0.289	Q8I3T5_PLAF7 Serine/arginine-rich splicing factor 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0517300 PE=1 SV=2
13	Q8VE97	1.01e-31	122	489	0.344	0.155	SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1
14	G3V798	1.74e-31	121	488	0.344	0.156	G3V798_RAT Serine and arginine rich splicing factor 4 OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=4 SV=1
15	Q08170	1.77e-31	122	494	0.344	0.154	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
16	Q802Y1	4.85e-30	116	366	0.348	0.210	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
17	Q8IJI0	2.53e-29	116	538	0.339	0.139	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
18	P26686	2.61e-28	111	376	0.339	0.199	SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4
19	Q13247	6.59e-27	107	344	0.326	0.209	SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2
20	G3V6S8	1.47e-26	106	339	0.326	0.212	SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus OX=10116 GN=Srsf6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	0.23	22.8	Nup53/35/40-type RNA recognition motif
2	PF00076 RRM_1	1.9e-30	115.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF08777 RRM_3	0.71	21.3	RNA binding motif
4	PF16367 RRM_7	17	16.9	RNA recognition motif
5	PF16842 RRM_occluded	1.6e+02	13.6	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019000

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003083	0.967	Serine/arginine-rich splicing factor 2
2	61853.ENSNLEP00000007942	0.937	Transformer 2 beta homolog (Drosophila)
3	61853.ENSNLEP00000019843	0.934	Serine/arginine-rich splicing factor 7
4	61853.ENSNLEP00000023868	0.917	Serine/arginine-rich splicing factor 1
5	61853.ENSNLEP00000007938	0.914	Serine/arginine-rich splicing factor 6
6	61853.ENSNLEP00000007006	0.907	RNA-binding protein 8A
7	61853.ENSNLEP00000010958	0.902	Serine/arginine repetitive matrix 1
8	61853.ENSNLEP00000010746	0.900	SRSF protein kinase 1
9	61853.ENSNLEP00000005998	0.897	Small nuclear ribonucleoprotein 70kDa (U1)
10	61853.ENSNLEP00000013040	0.897	Serine/arginine-rich splicing factor 3
11	61853.ENSNLEP00000002013	0.887	Cancer susceptibility candidate 3
12	61853.ENSNLEP00000002730	0.884	Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
13	61853.ENSNLEP00000019568	0.884	Splicing factor 3b, subunit 3, 130kDa
14	61853.ENSNLEP00000008368	0.872	Splicing factor 3b, subunit 1, 155kDa
15	61853.ENSNLEP00000018945	0.872	Small nuclear ribonucleoprotein D3 polypeptide 18kDa
16	61853.ENSNLEP00000007065	0.865	Small nuclear ribonucleoprotein polypeptide F
17	61853.ENSNLEP00000016003	0.859	Serine/arginine-rich splicing factor 10
18	61853.ENSNLEP00000012869	0.858	Necessary for the splicing of pre-mRNA.
19	61853.ENSNLEP00000001933	0.851	Small nuclear ribonucleoprotein 35kDa (U11/U12)
20	61853.ENSNLEP00000003432	0.846	RNA binding motif protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.978	mRNA binding
GO:0019904	0.787	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006396	0.985	RNA processing
GO:0050789	0.982	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0019222	0.965	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0008380	0.947	RNA splicing
GO:0010468	0.941	regulation of gene expression
GO:0031323	0.897	regulation of cellular metabolic process
GO:0000398	0.893	mRNA splicing, via spliceosome
GO:0080090	0.892	regulation of primary metabolic process
GO:0051171	0.892	regulation of nitrogen compound metabolic process
GO:0051252	0.866	regulation of RNA metabolic process
GO:0043484	0.855	regulation of RNA splicing
GO:0071840	0.838	cellular component organization or biogenesis
GO:0016043	0.827	cellular component organization
GO:0048519	0.815	negative regulation of biological process
GO:0048518	0.790	positive regulation of biological process
GO:0071826	0.777	ribonucleoprotein complex subunit organization
GO:1903311	0.728	regulation of mRNA metabolic process
GO:0010605	0.688	negative regulation of macromolecule metabolic process
GO:0010604	0.678	positive regulation of macromolecule metabolic process
GO:0050896	0.661	response to stimulus
GO:0022618	0.654	ribonucleoprotein complex assembly
GO:0010628	0.652	positive regulation of gene expression
GO:0048522	0.513	positive regulation of cellular process
GO:0010629	0.507	negative regulation of gene expression
GO:0048523	0.465	negative regulation of cellular process
GO:0009636	0.413	response to toxic substance
GO:0050684	0.368	regulation of mRNA processing
GO:0000245	0.363	spliceosomal complex assembly
GO:0051172	0.356	negative regulation of nitrogen compound metabolic process
GO:0031324	0.334	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.948	intracellular non-membrane-bounded organelle
GO:0005737	0.910	cytoplasm
GO:0032991	0.743	protein-containing complex
GO:0005730	0.339	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]