StarFunc result for job id Q13247

User Input

>input (344 residues)
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13247	0.999	0.999	6.215E-54	344	1.000	1.000	Q13247.pdb.gz	SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2
2	AFDB:Q08170	0.453	0.333	1.652E-34	494	0.683	0.476	Q08170.pdb.gz	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
3	AFDB:Q8VE97	0.485	0.355	2.601E-33	489	0.654	0.460	Q8VE97.pdb.gz	SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1
4	AFDB:Q802Y1	0.432	0.408	1.326E-32	366	0.616	0.579	Q802Y1.pdb.gz	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
5	AFDB:P26686	0.443	0.406	1.455E-30	376	0.610	0.559	P26686.pdb.gz	SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4
6	AFDB:A0A024R6D8	0.291	0.344	3.724E-30	272	0.485	0.614	A0A024R6D8.pdb.gz
7	AFDB:Q23120	0.316	0.377	3.545E-25	281	0.390	0.477	Q23120.pdb.gz	RSP2_CAEEL Probable splicing factor, arginine/serine-rich 2 OS=Caenorhabditis elegans OX=6239 GN=rsp-2 PE=3 SV=1
8	AFDB:P78814	0.405	0.384	1.953E-23	365	0.358	0.337	P78814.pdb.gz	SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp2 PE=1 SV=2
9	AFDB:Q9V3W7	0.235	0.307	1.517E-19	255	0.311	0.420	Q9V3W7.pdb.gz	Q9V3W7_DROME LD40489p OS=Drosophila melanogaster OX=7227 GN=SF2 PE=1 SV=1
10	AFDB:P92966	0.211	0.205	3.116E-17	356	0.297	0.287	P92966.pdb.gz	SRS41_ARATH Serine/arginine-rich splicing factor RS41 OS=Arabidopsis thaliana OX=3702 GN=RS41 PE=1 SV=2
11	PDB:7oqcF	0.201	0.255	1.230E-10	267	0.102	0.131	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	PDB:6y53o	0.236	0.416	2.956E-10	160	0.108	0.231	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	PDB:6y5qq	0.199	0.373	1.530E-8	178	0.087	0.169	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6r5kH	0.199	0.175	3.047E-8	394	0.113	0.099	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
15	PDB:5vsuA	0.190	0.170	3.454E-8	387	0.093	0.083	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
16	PDB:7evoD	0.206	0.349	6.879E-8	200	0.090	0.155	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:5lsbA	0.209	0.382	8.838E-8	176	0.076	0.148	5lsbA.pdb.gz
18	PDB:6ff7X	0.195	0.377	1.002E-7	171	0.084	0.170	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7dvqY	0.208	0.498	8.973E-7	140	0.073	0.179	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:3lqvB	0.194	0.569	2.296E-6	115	0.055	0.165	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V6S8	0.0	624	339	0.962	0.976	SRSF6_RAT Serine/arginine-rich splicing factor 6 OS=Rattus norvegicus OX=10116 GN=Srsf6 PE=1 SV=1
2	Q13247	0.0	652	344	1.000	1.000	SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2
3	Q3TWW8	0.0	624	339	0.962	0.976	SRSF6_MOUSE Serine/arginine-rich splicing factor 6 OS=Mus musculus OX=10090 GN=Srsf6 PE=1 SV=1
4	Q8VE97	3.49e-107	324	489	0.439	0.309	SRSF4_MOUSE Serine/arginine-rich splicing factor 4 OS=Mus musculus OX=10090 GN=Srsf4 PE=2 SV=1
5	G3V798	1.20e-106	322	488	0.439	0.309	G3V798_RAT Serine and arginine rich splicing factor 4 OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=4 SV=1
6	Q08170	3.80e-106	321	494	0.439	0.306	SRSF4_HUMAN Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2
7	Q802Y1	1.41e-87	270	366	0.384	0.361	Q802Y1_DANRE Serine and arginine-rich-splicing factor 4 OS=Danio rerio OX=7955 GN=zgc:55809 PE=1 SV=1
8	A0A8I5ZP75	2.42e-81	256	466	0.358	0.264	A0A8I5ZP75_RAT Serine and arginine rich splicing factor 4 OS=Rattus norvegicus OX=10116 GN=Srsf4 PE=1 SV=1
9	P26686	1.75e-75	239	376	0.352	0.322	SRR55_DROME Serine-arginine protein 55 OS=Drosophila melanogaster OX=7227 GN=B52 PE=1 SV=4
10	O35326	3.17e-72	227	269	0.340	0.435	SRSF5_MOUSE Serine/arginine-rich splicing factor 5 OS=Mus musculus OX=10090 GN=Srsf5 PE=1 SV=2
11	Q09167	3.17e-72	227	269	0.340	0.435	SRSF5_RAT Serine/arginine-rich splicing factor 5 OS=Rattus norvegicus OX=10116 GN=Srsf5 PE=1 SV=1
12	Q13243	3.48e-72	227	272	0.340	0.430	SRSF5_HUMAN Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1
13	Q23121	1.19e-51	175	312	0.424	0.468	RSP1_CAEEL Probable splicing factor, arginine/serine-rich 1 OS=Caenorhabditis elegans OX=6239 GN=rsp-1 PE=3 SV=1
14	Q23120	1.42e-48	166	281	0.320	0.391	RSP2_CAEEL Probable splicing factor, arginine/serine-rich 2 OS=Caenorhabditis elegans OX=6239 GN=rsp-2 PE=3 SV=1
15	P78814	4.56e-42	152	365	0.230	0.216	SRP2_SCHPO Pre-mRNA-splicing factor srp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srp2 PE=1 SV=2
16	B4DJK0	1.39e-39	138	124	0.218	0.605	B4DJK0_HUMAN Serine and arginine rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1
17	B4DUA4	1.61e-39	138	138	0.218	0.543	B4DUA4_HUMAN Serine and arginine rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1
18	Q8IJI0	3.10e-33	131	538	0.294	0.188	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
19	Q5PPI1	1.16e-30	117	221	0.218	0.339	SRSF9_RAT Serine/arginine-rich splicing factor 9 OS=Rattus norvegicus OX=10116 GN=Srsf9 PE=1 SV=1
20	O22315	3.59e-30	118	303	0.259	0.294	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03880 DbpA	84	14.6	DbpA RNA binding domain
2	PF14605 Nup35_RRM_2	13	17.2	Nup53/35/40-type RNA recognition motif
3	PF00076 RRM_1	1.1e-29	113.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF08777 RRM_3	0.0016	29.8	RNA binding motif
5	PF13893 RRM_5	3.9	18.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF16842 RRM_occluded	9.1	17.6	Occluded RNA-recognition motif
7	PF11767 SET_assoc	5.2e+02	11.7	Histone lysine methyltransferase SET associated
8	PF15657 Tox-HNH-EHHH	1.1e+02	14.6	HNH/Endo VII superfamily nuclease toxins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007938

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000010746	0.950	SRSF protein kinase 1
2	61853.ENSNLEP00000019000	0.914	Serine/arginine-rich splicing factor 9
3	61853.ENSNLEP00000007942	0.913	Transformer 2 beta homolog (Drosophila)
4	61853.ENSNLEP00000012869	0.905	Necessary for the splicing of pre-mRNA.
5	61853.ENSNLEP00000002099	0.896	Nuclear cap-binding protein subunit 2
6	61853.ENSNLEP00000023868	0.883	Serine/arginine-rich splicing factor 1
7	61853.ENSNLEP00000011456	0.875	Serine/arginine-rich splicing factor 11
8	61853.ENSNLEP00000005047	0.874	Nuclear RNA export factor 1
9	61853.ENSNLEP00000008368	0.847	Splicing factor 3b, subunit 1, 155kDa
10	61853.ENSNLEP00000013040	0.846	Serine/arginine-rich splicing factor 3
11	61853.ENSNLEP00000019843	0.839	Serine/arginine-rich splicing factor 7
12	61853.ENSNLEP00000003083	0.838	Serine/arginine-rich splicing factor 2
13	61853.ENSNLEP00000003432	0.836	RNA binding motif protein 25
14	61853.ENSNLEP00000020555	0.834	Nuclear cap binding protein subunit 1, 80kDa
15	61853.ENSNLEP00000012561	0.828	Aly/REF export factor
16	61853.ENSNLEP00000009205	0.827	Uncharacterized protein
17	61853.ENSNLEP00000009195	0.819	Uncharacterized protein
18	61853.ENSNLEP00000009224	0.819	Nuclear RNA export factor 3
19	61853.ENSNLEP00000001933	0.818	Small nuclear ribonucleoprotein 35kDa (U11/U12)
20	61853.ENSNLEP00000019824	0.803	Heterogeneous nuclear ribonucleoprotein L-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0036002	1.000	pre-mRNA binding
GO:0003729	0.666	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0071704	0.980	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0050794	0.968	regulation of cellular process
GO:0048519	0.944	negative regulation of biological process
GO:0006807	0.929	nitrogen compound metabolic process
GO:0060255	0.921	regulation of macromolecule metabolic process
GO:0000375	0.912	RNA splicing, via transesterification reactions
GO:0010629	0.901	negative regulation of gene expression
GO:0006397	0.877	mRNA processing
GO:0048523	0.865	negative regulation of cellular process
GO:1903311	0.843	regulation of mRNA metabolic process
GO:0043484	0.837	regulation of RNA splicing
GO:0050896	0.777	response to stimulus
GO:1901698	0.761	response to nitrogen compound
GO:0009719	0.734	response to endogenous stimulus
GO:0010033	0.717	response to organic substance
GO:1901700	0.665	response to oxygen-containing compound
GO:0000398	0.662	mRNA splicing, via spliceosome
GO:0071840	0.623	cellular component organization or biogenesis
GO:0051253	0.615	negative regulation of RNA metabolic process
GO:1903312	0.605	negative regulation of mRNA metabolic process
GO:0042981	0.588	regulation of apoptotic process
GO:0010243	0.573	response to organonitrogen compound
GO:0043069	0.551	negative regulation of programmed cell death
GO:0050684	0.550	regulation of mRNA processing
GO:0016043	0.518	cellular component organization
GO:0048518	0.489	positive regulation of biological process
GO:0033119	0.449	negative regulation of RNA splicing
GO:0048522	0.438	positive regulation of cellular process
GO:1901652	0.389	response to peptide
GO:0043066	0.386	negative regulation of apoptotic process
GO:0044085	0.323	cellular component biogenesis
GO:0022607	0.311	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016604	0.837	nuclear body
GO:0016607	0.790	nuclear speck
GO:0005737	0.786	cytoplasm
GO:0032991	0.685	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]