StarFunc result for job id Q13253

User Input

>input (232 residues)
MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKD
LNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
KGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFS
KRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97466	0.984	0.984	2.100E-44	232	0.991	0.991	P97466.pdb.gz	NOGG_MOUSE Noggin OS=Mus musculus OX=10090 GN=Nog PE=2 SV=1
2	AFDB:F1NAM3	0.873	0.533	6.627E-36	387	0.802	0.481	F1NAM3.pdb.gz
3	PDB:1m4uA	0.832	0.967	4.303E-35	199	0.853	0.995	1m4uA.pdb.gz
4	AFDB:P49011	0.889	0.928	1.339E-34	222	0.754	0.788	P49011.pdb.gz	NOGG_XENLA Noggin OS=Xenopus laevis OX=8355 GN=nog PE=1 SV=1
5	AFDB:Q9YHV3	0.854	0.887	3.001E-29	223	0.586	0.610	Q9YHV3.pdb.gz	NOGG3_DANRE Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1
6	AFDB:Q9W741	0.814	0.871	5.391E-28	216	0.565	0.606	Q9W741.pdb.gz	NOGG1_DANRE Noggin-1 OS=Danio rerio OX=7955 GN=nog1 PE=2 SV=1
7	PDB:7ag0A	0.551	0.898	1.057E-22	140	0.603	1.000	7ag0A.pdb.gz
8	AFDB:Q9W740	0.763	0.833	3.490E-22	212	0.440	0.481	Q9W740.pdb.gz	NOGG2_DANRE Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1
9	AFDB:Q24155	0.383	0.392	1.212E-7	226	0.164	0.168	Q24155.pdb.gz	TRUNK_DROME Protein trunk OS=Drosophila melanogaster OX=7227 GN=trk PE=3 SV=1
10	AFDB:X2JCX9	0.280	0.296	1.616E-5	218	0.155	0.165	X2JCX9.pdb.gz	X2JCX9_DROME Prothoracicotropic hormone, isoform F OS=Drosophila melanogaster OX=7227 GN=Ptth PE=4 SV=1
11	AFDB:O43915	0.249	0.175	2.902E-4	354	0.142	0.093	O43915.pdb.gz	VEGFD_HUMAN Vascular endothelial growth factor D OS=Homo sapiens OX=9606 GN=VEGFD PE=1 SV=1
12	PDB:1wq8A	0.218	0.405	2.684E-3	100	0.065	0.150	1wq8A.pdb.gz
13	PDB:4qhuC	0.238	0.414	9.255E-3	119	0.060	0.118	4qhuC.pdb.gz
14	PDB:6hgoC	0.236	0.390	1.770E-2	127	0.082	0.150	6hgoC.pdb.gz
15	AFDB:Q9VM39	0.227	0.097	4.103E-2	651	0.099	0.035	Q9VM39.pdb.gz	Q9VM39_DROME FI06402p OS=Drosophila melanogaster OX=7227 GN=Pvf3 PE=2 SV=2
16	PDB:5nxsA	0.244	0.199	4.822E-2	290	0.069	0.055	5nxsA.pdb.gz
17	PDB:7uwmA	0.225	0.423	5.425E-2	109	0.052	0.110	7uwmA.pdb.gz
18	PDB:5vqfB	0.248	0.187	5.754E-2	320	0.069	0.050	5vqfB.pdb.gz
19	PDB:5ntuA	0.237	0.184	1.037E-1	308	0.069	0.052	5ntuA.pdb.gz
20	PDB:7y1rB	0.219	0.172	1.037E-1	308	0.069	0.052	7y1rB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13253	3.08e-172	474	232	1.000	1.000	NOGG_HUMAN Noggin OS=Homo sapiens OX=9606 GN=NOG PE=1 SV=1
2	P97466	1.65e-170	470	232	0.991	0.991	NOGG_MOUSE Noggin OS=Mus musculus OX=10090 GN=Nog PE=2 SV=1
3	O93525	6.68e-128	362	223	0.797	0.830	NOGG_CHICK Noggin OS=Gallus gallus OX=9031 GN=NOG PE=2 SV=1
4	P49011	2.02e-121	345	222	0.754	0.788	NOGG_XENLA Noggin OS=Xenopus laevis OX=8355 GN=nog PE=1 SV=1
5	Q62809	1.55e-100	290	144	0.612	0.986	NOGG_RAT Noggin (Fragment) OS=Rattus norvegicus OX=10116 GN=Nog PE=2 SV=1
6	Q9YHV3	3.55e-98	287	223	0.591	0.614	NOGG3_DANRE Noggin-3 OS=Danio rerio OX=7955 GN=nog3 PE=1 SV=1
7	Q9W741	1.85e-81	244	216	0.560	0.602	NOGG1_DANRE Noggin-1 OS=Danio rerio OX=7955 GN=nog1 PE=2 SV=1
8	Q9W740	1.68e-63	198	212	0.448	0.491	NOGG2_DANRE Noggin-2 OS=Danio rerio OX=7955 GN=nog2 PE=2 SV=1
9	Q804S5	0.99	33.1	1030	0.103	0.023	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1
10	Q24155	3.3	30.8	226	0.082	0.084	TRUNK_DROME Protein trunk OS=Drosophila melanogaster OX=7227 GN=trk PE=3 SV=1
11	A0A0G2JTE7	5.8	30.8	3494	0.073	0.005	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
12	A0A0G2K1F7	5.8	30.8	3512	0.073	0.005	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
13	M9PCA7	6.2	30.4	1191	0.099	0.019	M9PCA7_DROME Sodium chloride cotransporter 69, isoform C OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
14	M9PI37	6.2	30.4	1207	0.099	0.019	M9PI37_DROME Sodium chloride cotransporter 69, isoform E OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
15	Q9VTW8	6.2	30.4	1171	0.099	0.020	Q9VTW8_DROME GH27027p OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
16	Q9QZZ4	6.9	30.4	3511	0.073	0.005	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2
17	Q9VU52	7.3	30.4	715	0.082	0.027	SNKY_DROME Protein sneaky OS=Drosophila melanogaster OX=7227 GN=snky PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05806 Noggin	5.6e-103	354.9	Noggin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000022461

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008592	0.996	Bone morphogenetic protein 7
2	61853.ENSNLEP00000017108	0.983	Bone morphogenetic protein 2
3	61853.ENSNLEP00000015368	0.979	Bone morphogenetic protein 4
4	61853.ENSNLEP00000003942	0.962	Bone morphogenetic protein 5
5	61853.ENSNLEP00000012475	0.941	Growth differentiation factor 5
6	61853.ENSNLEP00000004305	0.898	Growth differentiation factor 6
7	61853.ENSNLEP00000023757	0.878	Bone morphogenetic protein receptor, type IA
8	61853.ENSNLEP00000003185	0.872	Growth differentiation factor 7
9	61853.ENSNLEP00000014621	0.860	Uncharacterized protein
10	61853.ENSNLEP00000017197	0.826	Serine/threonine-protein kinase receptor
11	61853.ENSNLEP00000008547	0.821	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
12	61853.ENSNLEP00000014208	0.749	Bone morphogenetic protein 6
13	61853.ENSNLEP00000020689	0.726	BMP and activin membrane-bound inhibitor homolog
14	61853.ENSNLEP00000018294	0.722	GATA binding protein 4
15	61853.ENSNLEP00000017622	0.706	Repulsive guidance molecule family member b
16	61853.ENSNLEP00000001001	0.696	Serine/threonine-protein kinase receptor
17	61853.ENSNLEP00000007814	0.696	Chordin
18	61853.ENSNLEP00000006914	0.695	Sclerostin
19	61853.ENSNLEP00000000534	0.694	NK2 homeobox 5
20	61853.ENSNLEP00000014132	0.691	R-spondin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0050794	0.995	regulation of cellular process
GO:0007275	0.994	multicellular organism development
GO:2000026	0.992	regulation of multicellular organismal development
GO:0051716	0.991	cellular response to stimulus
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0080090	0.990	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0031323	0.990	regulation of cellular metabolic process
GO:0045596	0.987	negative regulation of cell differentiation
GO:0048513	0.985	animal organ development
GO:0090288	0.977	negative regulation of cellular response to growth factor stimulus
GO:0051241	0.976	negative regulation of multicellular organismal process
GO:0030510	0.976	regulation of BMP signaling pathway
GO:0090101	0.976	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.974	cellular response to growth factor stimulus
GO:0048731	0.974	system development
GO:0009653	0.971	anatomical structure morphogenesis
GO:0030514	0.970	negative regulation of BMP signaling pathway
GO:0001932	0.966	regulation of protein phosphorylation
GO:0007154	0.964	cell communication
GO:0023052	0.963	signaling
GO:0071773	0.958	cellular response to BMP stimulus
GO:0060393	0.958	regulation of pathway-restricted SMAD protein phosphorylation
GO:0009887	0.949	animal organ morphogenesis
GO:0007165	0.947	signal transduction
GO:0007167	0.925	enzyme-linked receptor protein signaling pathway
GO:0019219	0.920	regulation of nucleobase-containing compound metabolic process
GO:0048869	0.906	cellular developmental process
GO:1903506	0.905	regulation of nucleic acid-templated transcription
GO:0030154	0.896	cell differentiation
GO:0007399	0.876	nervous system development
GO:0048518	0.874	positive regulation of biological process
GO:0009790	0.870	embryo development
GO:0001501	0.861	skeletal system development
GO:0048598	0.858	embryonic morphogenesis
GO:0060322	0.854	head development
GO:0007417	0.846	central nervous system development
GO:0009893	0.840	positive regulation of metabolic process
GO:0048522	0.825	positive regulation of cellular process
GO:0007420	0.819	brain development
GO:0010604	0.809	positive regulation of macromolecule metabolic process
GO:0010468	0.808	regulation of gene expression
GO:0051173	0.799	positive regulation of nitrogen compound metabolic process
GO:0006355	0.795	regulation of DNA-templated transcription
GO:0009892	0.786	negative regulation of metabolic process
GO:0031324	0.779	negative regulation of cellular metabolic process
GO:0031325	0.760	positive regulation of cellular metabolic process
GO:0051147	0.752	regulation of muscle cell differentiation
GO:0009888	0.733	tissue development
GO:0031327	0.732	negative regulation of cellular biosynthetic process
GO:0065009	0.727	regulation of molecular function
GO:0023056	0.716	positive regulation of signaling
GO:0042127	0.711	regulation of cell population proliferation
GO:0051094	0.698	positive regulation of developmental process
GO:0010647	0.691	positive regulation of cell communication
GO:0010605	0.685	negative regulation of macromolecule metabolic process
GO:0045936	0.679	negative regulation of phosphate metabolic process
GO:0051172	0.676	negative regulation of nitrogen compound metabolic process
GO:0007169	0.675	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051148	0.665	negative regulation of muscle cell differentiation
GO:0035295	0.633	tube development
GO:0045667	0.619	regulation of osteoblast differentiation
GO:0044344	0.574	cellular response to fibroblast growth factor stimulus
GO:0060429	0.553	epithelium development
GO:0001822	0.549	kidney development
GO:0048568	0.514	embryonic organ development
GO:0009953	0.512	dorsal/ventral pattern formation
GO:0006357	0.502	regulation of transcription by RNA polymerase II
GO:0043009	0.501	chordate embryonic development
GO:0035239	0.501	tube morphogenesis
GO:0048562	0.497	embryonic organ morphogenesis
GO:0048705	0.495	skeletal system morphogenesis
GO:0008284	0.494	positive regulation of cell population proliferation
GO:0010721	0.474	negative regulation of cell development
GO:0051240	0.462	positive regulation of multicellular organismal process
GO:0048706	0.446	embryonic skeletal system development
GO:0008543	0.443	fibroblast growth factor receptor signaling pathway
GO:0045893	0.440	positive regulation of DNA-templated transcription
GO:0030900	0.439	forebrain development
GO:0045668	0.421	negative regulation of osteoblast differentiation
GO:0014014	0.405	negative regulation of gliogenesis
GO:0045934	0.403	negative regulation of nucleobase-containing compound metabolic process
GO:0003008	0.400	system process
GO:0048584	0.389	positive regulation of response to stimulus
GO:0050877	0.384	nervous system process
GO:0048729	0.365	tissue morphogenesis
GO:0045944	0.347	positive regulation of transcription by RNA polymerase II
GO:0009967	0.343	positive regulation of signal transduction
GO:0045685	0.337	regulation of glial cell differentiation
GO:0002009	0.335	morphogenesis of an epithelium
GO:0060562	0.328	epithelial tube morphogenesis
GO:0042221	0.309	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0043226	0.765	organelle
GO:0005622	0.757	intracellular anatomical structure
GO:0043227	0.716	membrane-bounded organelle
GO:0043229	0.683	intracellular organelle
GO:0043231	0.640	intracellular membrane-bounded organelle
GO:0005737	0.586	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]