StarFunc result for job id Q13255

User Input

>input (1194 residues)
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQ
QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
QLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0ZKH5	0.706	0.712	0.000	1184	0.852	0.859	H0ZKH5.pdb.gz	H0ZKH5_TAEGU Glutamate metabotropic receptor 1 OS=Taeniopygia guttata OX=59729 GN=GRM1 PE=3 SV=2
2	AFDB:H0ZRP5	0.685	0.658	0.000	1243	0.625	0.600	H0ZRP5.pdb.gz	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
3	AFDB:P23385	0.854	0.850	0.000	1199	0.944	0.940	P23385.pdb.gz	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
4	AFDB:P41594	0.683	0.673	0.000	1212	0.612	0.603	P41594.pdb.gz	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
5	PDB:7e9gR	0.559	0.835	4.747E-69	769	0.302	0.469	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
6	PDB:7epcA	0.554	0.811	1.622E-65	782	0.280	0.427	7epcA.pdb.gz
7	PDB:7epaA	0.562	0.825	5.082E-64	782	0.298	0.455	7epaA.pdb.gz
8	PDB:7e9hR	0.536	0.799	4.570E-63	766	0.286	0.446	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
9	PDB:7wihA	0.531	0.818	4.058E-60	741	0.276	0.445	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
10	PDB:7dtvA	0.564	0.843	6.935E-50	779	0.189	0.290	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
11	PDB:7c7sA	0.283	0.450	5.329E-32	685	0.115	0.200	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
12	PDB:6w2xB	0.283	0.432	3.274E-26	669	0.113	0.202	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
13	PDB:6ffhA	0.198	0.563	9.632E-23	414	0.156	0.449	6ffhA.pdb.gz	Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures.
14	PDB:4tllA	0.237	0.354	1.243E-15	767	0.073	0.113	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
15	AFDB:Q8C419	0.216	0.215	1.708E-14	1200	0.105	0.104	Q8C419.pdb.gz	MGLYR_MOUSE Metabotropic glycine receptor OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2
16	AFDB:B7ZSK1	0.228	0.193	2.406E-13	1451	0.127	0.105	B7ZSK1.pdb.gz	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
17	AFDB:A0A0R4IF44	0.222	0.153	3.247E-13	1792	0.099	0.066	A0A0R4IF44.pdb.gz
18	AFDB:Q9Z173	0.159	0.127	3.793E-6	1550	0.064	0.050	Q9Z173.pdb.gz	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
19	AFDB:Q2U5X6	0.119	0.169	1.249E-4	775	0.065	0.101	Q2U5X6.pdb.gz	Q2U5X6_ASPOR PH signal transduction protein PalH OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090120000469 PE=4 SV=1
20	AFDB:F1R8J2	0.146	0.092	5.312E-4	2014	0.060	0.036	F1R8J2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KF15	659	1472	0.296	0.240	A0A0B4KF15_DROME Mangetout, isoform G OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
2	A1L1T5	655	905	0.297	0.392	A1L1T5_DANRE Glutamate receptor, metabotropic 6b OS=Danio rerio OX=7955 GN=cb496 PE=2 SV=1
3	A1Z7F4	657	1095	0.293	0.320	A1Z7F4_DROME Mangetout, isoform E OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
4	A1Z7F5	657	1248	0.296	0.284	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
5	B7YZT0	658	1415	0.296	0.250	B7YZT0_DROME Mangetout, isoform D OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
6	H0ZKH5	1993	1184	0.857	0.864	H0ZKH5_TAEGU Glutamate metabotropic receptor 1 OS=Taeniopygia guttata OX=59729 GN=GRM1 PE=3 SV=2
7	H0ZRP5	1335	1243	0.532	0.511	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
8	O00222	656	908	0.304	0.400	GRM8_HUMAN Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2
9	O15303	629	877	0.290	0.395	GRM6_HUMAN Metabotropic glutamate receptor 6 OS=Homo sapiens OX=9606 GN=GRM6 PE=1 SV=2
10	P23385	2200	1199	0.939	0.935	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
11	P31421	691	872	0.313	0.429	GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Grm2 PE=1 SV=1
12	P31422	682	879	0.309	0.420	GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1
13	P31423	658	912	0.302	0.395	GRM4_RAT Metabotropic glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Grm4 PE=1 SV=1
14	P31424	1431	1203	0.619	0.614	GRM5_RAT Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2
15	P35349	608	871	0.286	0.393	GRM6_RAT Metabotropic glutamate receptor 6 OS=Rattus norvegicus OX=10116 GN=Grm6 PE=2 SV=1
16	P35400	660	915	0.310	0.404	GRM7_RAT Metabotropic glutamate receptor 7 OS=Rattus norvegicus OX=10116 GN=Grm7 PE=1 SV=1
17	P41594	1423	1212	0.616	0.606	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
18	P47743	654	908	0.300	0.394	GRM8_MOUSE Metabotropic glutamate receptor 8 OS=Mus musculus OX=10090 GN=Grm8 PE=1 SV=2
19	P70579	652	908	0.302	0.398	GRM8_RAT Metabotropic glutamate receptor 8 OS=Rattus norvegicus OX=10116 GN=Grm8 PE=1 SV=1
20	P91685	638	976	0.295	0.361	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	1.4e-52	190.6	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF13872 AAA_34	6.5e+02	10.6	P-loop containing NTP hydrolase pore-1
3	PF01094 ANF_receptor	4.3e-93	323.9	Receptor family ligand binding region
4	PF17506 DUF5438	61	15.4	Family of unknown function (DUF5438)
5	PF10080 FtrD-like	2.1e+02	13.4	Membrane iron-sulfur containing protein FtrD-like
6	PF10606 GluR_Homer-bdg	4.7e-21	86.0	Homer-binding domain of metabotropic glutamate receptor
7	PF07562 NCD3G	1.8e-11	55.1	Nine Cysteines Domain of family 3 GPCR

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354896

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.995	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000334382	0.995	Homer protein homolog 1
3	9606.ENSP00000420194	0.980	Extracellular calcium-sensing receptor
4	9606.ENSP00000439937	0.973	Homer protein homolog 3
5	9606.ENSP00000306138	0.970	Metabotropic glutamate receptor 5
6	9606.ENSP00000405330	0.970	Estrogen receptor
7	9606.ENSP00000305632	0.968	Homer protein homolog 2
8	9606.ENSP00000338185	0.952	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
9	9606.ENSP00000366233	0.930	Gamma-aminobutyric acid type B receptor subunit 1
10	9606.ENSP00000381412	0.923	Calcium/calmodulin-dependent protein kinase type II subunit alpha
11	9606.ENSP00000379098	0.915	Calcium/calmodulin-dependent protein kinase type II subunit beta
12	9606.ENSP00000386972	0.908	Calcitonin gene-related peptide type 1 receptor
13	9606.ENSP00000254661	0.907	Receptor activity-modifying protein 1
14	9606.ENSP00000316377	0.906	Disks large-associated protein 1
15	9606.ENSP00000242249	0.904	Receptor activity-modifying protein 3
16	9606.ENSP00000253796	0.903	Receptor activity-modifying protein 2
17	9606.ENSP00000432568	0.893	Spectrin beta chain, non-erythrocytic 2
18	9606.ENSP00000293441	0.890	SH3 and multiple ankyrin repeat domains protein 1
19	9606.ENSP00000449241	0.888	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
20	9606.ENSP00000339740	0.873	Calcium/calmodulin-dependent protein kinase type II subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008066	1.000	glutamate receptor activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.999	protein binding
GO:0098988	0.680	G protein-coupled glutamate receptor activity
GO:0008134	0.309	transcription factor binding
GO:0030331	0.302	nuclear estrogen receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.996	signaling
GO:0007154	0.988	cell communication
GO:0051716	0.985	cellular response to stimulus
GO:0007165	0.977	signal transduction
GO:0007186	0.965	G protein-coupled receptor signaling pathway
GO:0007215	0.950	glutamate receptor signaling pathway
GO:0032501	0.940	multicellular organismal process
GO:0007267	0.926	cell-cell signaling
GO:0007200	0.900	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0065008	0.899	regulation of biological quality
GO:0099536	0.898	synaptic signaling
GO:0007268	0.886	chemical synaptic transmission
GO:0023051	0.868	regulation of signaling
GO:0010646	0.868	regulation of cell communication
GO:0003008	0.765	system process
GO:0007204	0.758	positive regulation of cytosolic calcium ion concentration
GO:0050877	0.701	nervous system process
GO:0042391	0.626	regulation of membrane potential
GO:0048583	0.601	regulation of response to stimulus
GO:0051239	0.596	regulation of multicellular organismal process
GO:0044057	0.513	regulation of system process
GO:0048518	0.509	positive regulation of biological process
GO:0099177	0.462	regulation of trans-synaptic signaling
GO:0050804	0.450	modulation of chemical synaptic transmission
GO:0051179	0.419	localization
GO:0006810	0.396	transport
GO:0048522	0.383	positive regulation of cellular process
GO:0009966	0.370	regulation of signal transduction
GO:0042221	0.364	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.923	intracellular anatomical structure
GO:0043226	0.752	organelle
GO:0043005	0.693	neuron projection
GO:0005737	0.680	cytoplasm
GO:0043227	0.669	membrane-bounded organelle
GO:0098590	0.660	plasma membrane region
GO:0045202	0.643	synapse
GO:0036477	0.595	somatodendritic compartment
GO:0043229	0.505	intracellular organelle
GO:0098794	0.395	postsynapse
GO:0097447	0.382	dendritic tree
GO:0098978	0.381	glutamatergic synapse
GO:0043231	0.372	intracellular membrane-bounded organelle
GO:0097060	0.362	synaptic membrane
GO:0032991	0.356	protein-containing complex
GO:0030425	0.344	dendrite
GO:0098984	0.307	neuron to neuron synapse
GO:0045211	0.302	postsynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]