StarFunc result for job id Q13257

User Input

>input (205 residues)
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13257	1.000	1.000	2.467E-42	205	1.000	1.000	Q13257.pdb.gz	MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens OX=9606 GN=MAD2L1 PE=1 SV=1
2	PDB:2v64A	0.951	0.928	9.594E-37	210	0.990	0.967	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
3	AFDB:Q556Y9	0.923	0.932	2.126E-30	203	0.615	0.621	Q556Y9.pdb.gz	MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum OX=44689 GN=mad2l1-1 PE=3 SV=1
4	AFDB:Q9NGT3	0.919	0.928	2.650E-28	203	0.498	0.502	Q9NGT3.pdb.gz	Q9NGT3_CAEEL HORMA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mdf-2 PE=1 SV=1
5	AFDB:Q5BAB9	0.889	0.812	7.151E-27	225	0.454	0.413	Q5BAB9.pdb.gz	Q5BAB9_EMENI Mitotic spindle checkpoint protein (Mad2), putative (AFU_orthologue AFUA_3G14340) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02511 PE=3 SV=1
6	AFDB:Q9VRQ2	0.935	0.926	9.597E-27	207	0.434	0.430	Q9VRQ2.pdb.gz	Q9VRQ2_DROME Mad2 OS=Drosophila melanogaster OX=7227 GN=mad2 PE=1 SV=1
7	AFDB:Q9LU93	0.914	0.897	1.205E-25	209	0.449	0.440	Q9LU93.pdb.gz	MAD2_ARATH Mitotic spindle checkpoint protein MAD2 OS=Arabidopsis thaliana OX=3702 GN=MAD2 PE=1 SV=1
8	AFDB:O14417	0.871	0.879	2.171E-25	203	0.444	0.448	O14417.pdb.gz	MAD2_SCHPO Mitotic spindle checkpoint component mad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad2 PE=1 SV=1
9	AFDB:Q59VQ3	0.860	0.825	2.155E-24	214	0.380	0.364	Q59VQ3.pdb.gz	MAD2_CANAL Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAD2 PE=3 SV=1
10	AFDB:Q57ZD6	0.858	0.874	3.253E-24	201	0.390	0.398	Q57ZD6.pdb.gz	Q57ZD6_TRYB2 Rev7, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.370 PE=4 SV=1
11	AFDB:P40958	0.879	0.918	1.336E-23	196	0.405	0.423	P40958.pdb.gz	MAD2_YEAST Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD2 PE=1 SV=1
12	PDB:4aezH	0.821	0.908	1.393E-23	185	0.429	0.476	4aezH.pdb.gz
13	PDB:3abdA	0.763	0.865	2.228E-15	180	0.210	0.239	3abdA.pdb.gz	Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase {zeta} and REV1
14	PDB:6keaD	0.806	0.298	5.669E-14	584	0.210	0.074	6keaD.pdb.gz
15	PDB:6bi7G	0.641	0.840	3.671E-11	154	0.195	0.260	6bi7G.pdb.gz	Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex.
16	PDB:4trkA	0.751	0.646	1.115E-9	242	0.132	0.112	4trkA.pdb.gz
17	PDB:7lxdE	0.645	0.645	1.320E-8	205	0.176	0.176	7lxdE.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
18	PDB:7lxdD	0.615	0.750	3.977E-6	163	0.156	0.196	7lxdD.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.
19	PDB:4yk8A	0.416	0.510	1.348E-3	162	0.117	0.148	4yk8A.pdb.gz
20	PDB:6f0xP	0.338	0.354	5.826E-2	194	0.102	0.108	6f0xP.pdb.gz	Mechanism for remodelling of the cell cycle checkpoint protein MAD2 by the ATPase TRIP13.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13257	3.74e-151	419	205	1.000	1.000	MD2L1_HUMAN Mitotic spindle assembly checkpoint protein MAD2A OS=Homo sapiens OX=9606 GN=MAD2L1 PE=1 SV=1
2	Q9Z1B5	2.64e-141	394	205	0.941	0.941	MD2L1_MOUSE Mitotic spindle assembly checkpoint protein MAD2A OS=Mus musculus OX=10090 GN=Mad2l1 PE=1 SV=2
3	Q556Y9	1.03e-88	261	203	0.605	0.611	MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum OX=44689 GN=mad2l1-1 PE=3 SV=1
4	Q9NGT3	3.72e-69	211	203	0.498	0.502	Q9NGT3_CAEEL HORMA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mdf-2 PE=1 SV=1
5	O14417	4.06e-64	199	203	0.444	0.448	MAD2_SCHPO Mitotic spindle checkpoint component mad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mad2 PE=1 SV=1
6	Q9LU93	2.63e-63	197	209	0.439	0.431	MAD2_ARATH Mitotic spindle checkpoint protein MAD2 OS=Arabidopsis thaliana OX=3702 GN=MAD2 PE=1 SV=1
7	Q5BAB9	5.24e-63	196	225	0.454	0.413	Q5BAB9_EMENI Mitotic spindle checkpoint protein (Mad2), putative (AFU_orthologue AFUA_3G14340) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02511 PE=3 SV=1
8	Q9VRQ2	6.03e-62	193	207	0.444	0.440	Q9VRQ2_DROME Mad2 OS=Drosophila melanogaster OX=7227 GN=mad2 PE=1 SV=1
9	Q57ZD6	4.92e-52	168	201	0.410	0.418	Q57ZD6_TRYB2 Rev7, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.370 PE=4 SV=1
10	P40958	8.26e-49	159	196	0.415	0.434	MAD2_YEAST Mitotic spindle checkpoint component MAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAD2 PE=1 SV=1
11	Q59VQ3	2.10e-47	156	214	0.410	0.393	MAD2_CANAL Spindle assembly checkpoint component MAD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAD2 PE=3 SV=1
12	Q8T870	1.26e-32	115	116	0.244	0.431	Q8T870_CAEEL HORMA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mdf-2 PE=1 SV=1
13	Q9VNE1	5.09e-10	58.9	198	0.200	0.207	POLZ2_DROME DNA polymerase zeta subunit 2 OS=Drosophila melanogaster OX=7227 GN=PolZ2 PE=1 SV=1
14	Q8QFR4	6.14e-10	58.5	211	0.195	0.190	MD2L2_XENLA Mitotic spindle assembly checkpoint protein MAD2B OS=Xenopus laevis OX=8355 GN=mad2l2 PE=1 SV=1
15	Q0E7J8	7.02e-10	58.5	213	0.210	0.202	REV7_SCHPO DNA polymerase zeta processivity subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rev7 PE=3 SV=1
16	Q4KWZ6	5.53e-09	56.2	211	0.195	0.190	MD2L2_CHICK Mitotic spindle assembly checkpoint protein MAD2B OS=Gallus gallus OX=9031 GN=MAD2L2 PE=1 SV=1
17	D3Z8D9	7.52e-09	55.8	211	0.185	0.180	MD2L2_RAT Mitotic spindle assembly checkpoint protein MAD2B OS=Rattus norvegicus OX=10116 GN=Mad2l2 PE=2 SV=1
18	B1AK43	1.18e-08	55.1	197	0.200	0.208	B1AK43_HUMAN Mitotic arrest deficient 2 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=8
19	B1AK45	1.18e-08	54.3	167	0.185	0.228	B1AK45_HUMAN Mitotic spindle assembly checkpoint protein MAD2B (Fragment) OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=1
20	Q9UI95	1.58e-08	54.7	211	0.185	0.180	MD2L2_HUMAN Mitotic spindle assembly checkpoint protein MAD2B OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07855 ATG101	6.8	18.1	Autophagy-related protein 101
2	PF10033 ATG13	1.6e+02	13.4	Autophagy-related protein 13
3	PF18173 bacHORMA_2	3e+02	12.7	Bacterial HORMA domain 2
4	PF02301 HORMA	7.4e-20	83.0	HORMA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010363172.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010355762.1	0.999	Mitotic checkpoint protein BUB3 isoform X1
2	61622.XP_010358082.1	0.999	BUB1 mitotic checkpoint serine/threonine kinase B
3	61622.XP_010363257.1	0.999	Belongs to the protein kinase superfamily.
4	61622.XP_010364959.1	0.999	Mitotic spindle assembly checkpoint protein MAD1
5	61622.XP_010370177.1	0.999	Cell division cycle protein 20 homolog
6	61622.XP_010374551.1	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1 isoform X1
7	61622.XP_010365593.1	0.998	Fizzy/cell division cycle 20 related 1
8	61622.XP_010386834.1	0.995	Dual specificity protein kinase TTK isoform X1
9	61622.XP_010361280.1	0.994	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.
10	61622.XP_010373124.1	0.994	Cell division cycle protein 16 homolog isoform X1
11	61622.XP_010386392.1	0.994	Cell division cycle 23
12	61622.XP_010359552.1	0.993	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle
13	61622.XP_010369769.1	0.990	Belongs to the AAA ATPase family.
14	61622.XP_010384783.1	0.990	Cell division cycle protein 20 homolog B isoform X1
15	61622.XP_010377536.1	0.977	Anaphase-promoting complex subunit 7
16	61622.XP_010370968.1	0.976	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
17	61622.XP_010379626.1	0.975	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family
18	61622.XP_010360864.1	0.974	Belongs to the cyclin family.
19	61622.XP_010364215.1	0.967	Translocated promoter region, nuclear basket protein
20	61622.XP_010361834.1	0.965	Cell division cycle protein 27 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0051716	0.985	cellular response to stimulus
GO:0048523	0.967	negative regulation of cellular process
GO:0007154	0.961	cell communication
GO:0051783	0.959	regulation of nuclear division
GO:0022402	0.951	cell cycle process
GO:0051726	0.915	regulation of cell cycle
GO:0051784	0.876	negative regulation of nuclear division
GO:0007094	0.870	mitotic spindle assembly checkpoint signaling
GO:0071840	0.732	cellular component organization or biogenesis
GO:0006996	0.707	organelle organization
GO:0048583	0.690	regulation of response to stimulus
GO:0048518	0.687	positive regulation of biological process
GO:0009966	0.678	regulation of signal transduction
GO:0048522	0.644	positive regulation of cellular process
GO:0019222	0.435	regulation of metabolic process
GO:0060255	0.423	regulation of macromolecule metabolic process
GO:0080090	0.414	regulation of primary metabolic process
GO:0051171	0.414	regulation of nitrogen compound metabolic process
GO:1902531	0.412	regulation of intracellular signal transduction
GO:1901976	0.370	regulation of cell cycle checkpoint

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0000776	0.999	kinetochore
GO:0005819	0.997	spindle
GO:0031981	0.997	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0012505	0.978	endomembrane system
GO:0005829	0.903	cytosol
GO:0140513	0.792	nuclear protein-containing complex
GO:0031967	0.716	organelle envelope
GO:0005635	0.571	nuclear envelope
GO:0072686	0.550	mitotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]