StarFunc result for job id Q13261

User Input

>input (267 residues)
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13261	1.000	1.000	1.940E-40	267	1.000	1.000	Q13261.pdb.gz	I15RA_HUMAN Interleukin-15 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL15RA PE=1 SV=1
2	AFDB:Q60819	0.337	0.342	2.813E-21	263	0.532	0.540	Q60819.pdb.gz	I15RA_MOUSE Interleukin-15 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il15ra PE=1 SV=1
3	AFDB:F1M293	0.294	0.312	4.539E-21	251	0.494	0.526	F1M293.pdb.gz	F1M293_RAT Interleukin 15 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il15ra PE=4 SV=3
4	PDB:2xwbF	0.180	0.073	2.443E-3	714	0.052	0.020	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
5	PDB:4e0sB	0.209	0.066	3.103E-3	898	0.052	0.016	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
6	PDB:2q7zA	0.205	0.032	3.294E-3	1931	0.075	0.010	2q7zA.pdb.gz
7	PDB:8a7dQ	0.184	0.181	1.089E-2	273	0.049	0.048	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
8	PDB:3t5oA	0.193	0.062	1.156E-2	871	0.056	0.017	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
9	PDB:1c1zA	0.184	0.154	1.865E-2	326	0.037	0.031	1c1zA.pdb.gz
10	PDB:2gsxA	0.200	0.061	2.834E-2	951	0.060	0.017	2gsxA.pdb.gz
11	PDB:4a5wB	0.213	0.069	3.009E-2	871	0.056	0.017	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
12	PDB:7nycC	0.206	0.073	3.009E-2	809	0.049	0.016	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:1haqA	0.185	0.044	3.194E-2	1213	0.067	0.015	1haqA.pdb.gz
14	AFDB:Q02203	0.107	0.061	1.349E-1	525	0.124	0.063	Q02203.pdb.gz	YKY5_YEAST Uncharacterized protein YKR005C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKR005C PE=3 SV=2
15	AFDB:Q98931	0.117	0.044	2.934E-1	917	0.127	0.037	Q98931.pdb.gz	LRP8_CHICK Low-density lipoprotein receptor-related protein 8 OS=Gallus gallus OX=9031 GN=LRP8 PE=1 SV=1
16	AFDB:Q9LZ56	0.105	0.078	3.510E-1	399	0.157	0.105	Q9LZ56.pdb.gz	DOF51_ARATH Dof zinc finger protein DOF5.1 OS=Arabidopsis thaliana OX=3702 GN=DOF5.1 PE=2 SV=1
17	AFDB:A1XQX1	0.100	0.073	4.458E-1	449	0.135	0.080	A1XQX1.pdb.gz	NR1AB_DANRE Neurexin-1a-beta OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1
18	AFDB:A0A2R8QGQ2	0.107	0.094	4.733E-1	324	0.184	0.151	A0A2R8QGQ2.pdb.gz	A0A2R8QGQ2_DANRE Hepatitis A virus cellular receptor 1 OS=Danio rerio OX=7955 GN=DrTIM-4 PE=4 SV=1
19	AFDB:Q8R183	0.110	0.100	4.733E-1	305	0.157	0.138	Q8R183.pdb.gz	TIMD2_MOUSE T-cell immunoglobulin and mucin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Timd2 PE=1 SV=1
20	AFDB:Q86T13	0.153	0.102	5.024E-1	490	0.127	0.069	Q86T13.pdb.gz	CLC14_HUMAN C-type lectin domain family 14 member A OS=Homo sapiens OX=9606 GN=CLEC14A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13261	0.0	536	267	1.000	1.000	I15RA_HUMAN Interleukin-15 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL15RA PE=1 SV=1
2	F1M293	7.04e-77	235	251	0.502	0.534	F1M293_RAT Interleukin 15 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il15ra PE=4 SV=3
3	A0A8I6AI14	6.92e-75	231	277	0.491	0.473	A0A8I6AI14_RAT Interleukin 15 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il15ra PE=4 SV=1
4	Q60819	1.23e-71	222	263	0.494	0.502	I15RA_MOUSE Interleukin-15 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il15ra PE=1 SV=1
5	A0A8I6G839	2.35e-46	156	211	0.288	0.365	A0A8I6G839_RAT Interleukin 15 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il15ra PE=4 SV=1
6	A0A8I6ADB7	1.25e-34	125	180	0.199	0.294	A0A8I6ADB7_RAT Interleukin 15 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il15ra PE=4 SV=1
7	A0A8I5ZP92	2.05e-34	124	169	0.199	0.314	A0A8I5ZP92_RAT Interleukin 15 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il15ra PE=4 SV=1
8	Q601D1	0.022	38.5	1052	0.082	0.021	Q601D1_MESH2 p97 cilium adhesin paralog OS=Mesomycoplasma hyopneumoniae (strain 232) OX=295358 GN=mhp271 PE=1 SV=1
9	Q22328	0.15	35.8	622	0.075	0.032	LEV9_CAEEL Protein lev-9 OS=Caenorhabditis elegans OX=6239 GN=lev-9 PE=1 SV=3
10	B7YZG4	0.21	35.4	5368	0.116	0.006	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A0A0B4K7P8	0.22	35.4	5394	0.116	0.006	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	E1JH62	0.22	35.4	5388	0.116	0.006	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A0A0B4K7Y9	0.24	35.4	5408	0.116	0.006	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	B7YZG6	0.26	35.4	5479	0.116	0.006	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	E1JH63	0.26	35.4	5499	0.116	0.006	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	A0A0B4K718	0.28	35.0	4100	0.116	0.008	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A0A0B4K869	0.30	35.0	5434	0.116	0.006	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	A0A0B4K788	0.32	35.0	5462	0.116	0.006	A0A0B4K788_DROME Short stop, isoform AC OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	E1JH65	0.32	35.0	5458	0.116	0.006	E1JH65_DROME Short stop, isoform P OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	O15020	0.55	34.3	2390	0.124	0.014	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19402 RamS	14	17.5	Lanthionine-containing peptide SapB precursor RamS
2	PF00084 Sushi	44	16.0	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000003828

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000028267	0.998	Interleukin
2	9598.ENSPTRP00000040514	0.994	Interleukin 2 receptor, gamma
3	9598.ENSPTRP00000024676	0.988	Uncharacterized protein
4	9598.ENSPTRP00000001425	0.799	Tyrosine-protein kinase
5	9598.ENSPTRP00000028193	0.796	Interleukin-2
6	9598.ENSPTRP00000035490	0.759	Tyrosine-protein kinase
7	9598.ENSPTRP00000003210	0.696	Uncharacterized protein
8	9598.ENSPTRP00000040014	0.692	Uncharacterized protein
9	9598.ENSPTRP00000008822	0.676	Interferon gamma
10	9598.ENSPTRP00000029522	0.673	Interleukin 9
11	9598.ENSPTRP00000019785	0.670	Interleukin 11
12	9598.ENSPTRP00000029447	0.662	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages
13	9598.ENSPTRP00000049016	0.656	Tyrosine kinase 2
14	9598.ENSPTRP00000032433	0.651	Interleukin 6 (Interferon, beta 2)
15	9598.ENSPTRP00000035597	0.644	Uncharacterized protein
16	9598.ENSPTRP00000003208	0.635	Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granuloc [...]
17	9598.ENSPTRP00000029448	0.634	Uncharacterized protein
18	9598.ENSPTRP00000044414	0.626	Interleukin-13
19	9598.ENSPTRP00000003213	0.625	Uncharacterized protein
20	9598.ENSPTRP00000024523	0.620	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0019901	0.999	protein kinase binding
GO:0042010	0.942	interleukin-15 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.996	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0051716	0.989	cellular response to stimulus
GO:0023052	0.987	signaling
GO:0007154	0.987	cell communication
GO:0007166	0.981	cell surface receptor signaling pathway
GO:0071345	0.969	cellular response to cytokine stimulus
GO:0019221	0.958	cytokine-mediated signaling pathway
GO:0048518	0.932	positive regulation of biological process
GO:0050764	0.834	regulation of phagocytosis
GO:0051050	0.406	positive regulation of transport
GO:0048522	0.380	positive regulation of cellular process
GO:0050766	0.339	positive regulation of phagocytosis
GO:0002376	0.301	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0031410	1.000	cytoplasmic vesicle
GO:0012505	0.996	endomembrane system
GO:0009986	0.947	cell surface
GO:0005768	0.942	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]