StarFunc result for job id Q13263

User Input

>input (835 residues)
MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALE
LLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVC
KQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEA
HQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDH
QYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAIL
QIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTA
LLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSG
LMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAG
TPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTS
SGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVP
GEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPL
HQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKA
DVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08629	0.451	0.451	0.000	835	0.934	0.934	O08629.pdb.gz	TIF1B_RAT Transcription intermediary factor 1-beta OS=Rattus norvegicus OX=10116 GN=Trim28 PE=1 SV=2
2	PDB:7z36B	0.260	0.450	9.453E-34	446	0.328	0.614	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
3	AFDB:Q9U3Y7	0.278	0.216	6.582E-32	1133	0.291	0.214	Q9U3Y7.pdb.gz	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
4	AFDB:Q8IWZ5	0.274	0.309	2.013E-16	723	0.101	0.116	Q8IWZ5.pdb.gz	TRI42_HUMAN Tripartite motif-containing protein 42 OS=Homo sapiens OX=9606 GN=TRIM42 PE=1 SV=2
5	AFDB:Q19818	0.175	0.148	4.458E-16	1032	0.158	0.128	Q19818.pdb.gz	Q19818_CAEEL RING-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=nhl-2 PE=1 SV=2
6	AFDB:A0A0D9RNP7	0.232	0.235	1.406E-10	819	0.174	0.177	A0A0D9RNP7.pdb.gz	A0A0D9RNP7_CHLSB PML nuclear body scaffold OS=Chlorocebus sabaeus OX=60711 GN=PML PE=4 SV=1
7	PDB:4tn3B	0.200	0.432	2.841E-3	362	0.036	0.083	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
8	AFDB:B7YZK8	0.102	0.067	1.330E-1	1517	0.135	0.074	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
9	AFDB:F4KE59	0.053	0.034	1.330E-1	1311	0.066	0.042	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
10	AFDB:A4IJ58	0.053	0.053	1.576E-1	831	0.075	0.076	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
11	AFDB:Q9UIF8	0.111	0.047	2.628E-1	2168	0.119	0.046	Q9UIF8.pdb.gz	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
12	AFDB:Q8CB87	0.116	0.101	3.298E-1	973	0.111	0.096	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
13	PDB:4v6wAN	0.058	0.228	8.305E-1	150	0.022	0.120	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:4xj6A	0.062	0.113	8.305E-1	370	0.028	0.062	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
15	PDB:6sn1B	0.066	0.096	9.304E-1	503	0.025	0.042	6sn1B.pdb.gz
16	PDB:4v8mAG	0.053	0.224	9.848E-1	141	0.023	0.135	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:5xjt2	0.055	0.131	9.848E-1	217	0.022	0.083	5xjt2.pdb.gz	Structures of 7S mutant complexes
18	PDB:7mq8LT	0.073	0.071	1.168	869	0.030	0.029	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7y4sA	0.115	0.214	1.168	343	0.024	0.058	7y4sA.pdb.gz
20	PDB:7z0lB	0.085	0.161	1.384	370	0.018	0.041	7z0lB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0R0K9	0.0	935	460	0.551	1.000	M0R0K9_HUMAN Tripartite motif containing 28 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=1
2	O08629	0.0	1458	835	0.886	0.886	TIF1B_RAT Transcription intermediary factor 1-beta OS=Rattus norvegicus OX=10116 GN=Trim28 PE=1 SV=2
3	Q13263	0.0	1711	835	1.000	1.000	TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5
4	Q62318	0.0	1456	834	0.886	0.887	TIF1B_MOUSE Transcription intermediary factor 1-beta OS=Mus musculus OX=10090 GN=Trim28 PE=1 SV=3
5	Q9UPN9	2.44e-93	319	1127	0.190	0.141	TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens OX=9606 GN=TRIM33 PE=1 SV=3
6	Q99PP7	3.04e-93	319	1142	0.190	0.139	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
7	Q6E2N3	1.01e-87	304	1163	0.180	0.129	TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio OX=7955 GN=trim33 PE=2 SV=1
8	O15164	9.81e-85	294	1050	0.181	0.144	TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3
9	A0A8I6AI80	2.73e-84	293	1050	0.178	0.142	A0A8I6AI80_RAT Tripartite motif-containing 24 OS=Rattus norvegicus OX=10116 GN=Trim24 PE=4 SV=1
10	Q64127	1.53e-83	291	1051	0.181	0.144	TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus OX=10090 GN=Trim24 PE=1 SV=1
11	Q924W6	1.11e-51	198	1344	0.132	0.082	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
12	A0A0B4KHT0	1.39e-48	189	1125	0.202	0.150	A0A0B4KHT0_DROME Bonus, isoform E OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
13	A0A0B4KH12	1.44e-48	189	1119	0.202	0.151	A0A0B4KH12_DROME Bonus, isoform D OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
14	Q9VDK5	1.61e-48	188	1133	0.202	0.149	Q9VDK5_DROME Bonus, isoform A OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=2
15	A0A0B4KGE5	1.65e-48	188	1207	0.202	0.140	A0A0B4KGE5_DROME Bonus, isoform C OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
16	Q9U3Y7	1.65e-48	188	1133	0.202	0.149	Q9U3Y7_DROME Bonus OS=Drosophila melanogaster OX=7227 GN=bon PE=2 SV=1
17	A0A0B4KHG7	2.11e-48	188	1122	0.145	0.108	A0A0B4KHG7_DROME Bonus, isoform F OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
18	A8WHL4	2.62e-48	187	1125	0.145	0.108	A8WHL4_DROME Bonus, isoform B OS=Drosophila melanogaster OX=7227 GN=bon PE=1 SV=1
19	O15016	3.23e-48	188	1351	0.131	0.081	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
20	E7FAM5	1.24e-26	119	824	0.116	0.118	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	0.00032	31.8	PHD-finger
2	PF13831 PHD_2	29	15.5	PHD-finger
3	PF00643 zf-B_box	1.3e-08	46.1	B-box zinc finger
4	PF00097 zf-C3HC4	12	17.2	Zinc finger, C3HC4 type (RING finger)
5	PF13639 zf-RING_2	1.2	20.8	Ring finger domain
6	PF14634 zf-RING_5	3.5e-07	41.4	zinc-RING finger domain
7	PF13445 zf-RING_UBOX	0.22	22.9	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253024

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377060	0.998	Chromobox protein homolog 1
2	9606.ENSP00000351947	0.997	ATP-dependent helicase 1
3	9606.ENSP00000258149	0.996	E3 ubiquitin-protein ligase Mdm2
4	9606.ENSP00000362649	0.996	Histone deacetylase 1
5	9606.ENSP00000271640	0.994	Histone-lysine N-methyltransferase SETDB1
6	9606.ENSP00000354660	0.993	Melanoma-associated antigen C2
7	9606.ENSP00000363668	0.991	Death domain-associated protein 6
8	9606.ENSP00000209875	0.990	Chromobox protein homolog 5
9	9606.ENSP00000348056	0.990	SUMO-conjugating enzyme UBC9
10	9606.ENSP00000473093	0.989	Melanoma-associated antigen 3
11	9606.ENSP00000243644	0.983	Zinc finger protein 350
12	9606.ENSP00000418259	0.983	ZFP57 zinc finger protein
13	9606.ENSP00000278616	0.982	Serine-protein kinase ATM
14	9606.ENSP00000269305	0.980	Cellular tumor antigen p53
15	9606.ENSP00000371475	0.980	TP53-binding protein 1
16	9606.ENSP00000320147	0.979	Histone-lysine N-methyltransferase EZH2
17	9606.ENSP00000378402	0.974	Paired amphipathic helix protein Sin3a
18	9606.ENSP00000345571	0.973	Transcription factor E2F1
19	9606.ENSP00000268712	0.970	Nuclear receptor corepressor 1
20	9606.ENSP00000434024	0.969	Histone H2AX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.998	catalytic activity, acting on a protein
GO:0016740	0.998	transferase activity
GO:0003712	0.998	transcription coregulator activity
GO:0003677	0.996	DNA binding
GO:0003682	0.564	chromatin binding
GO:0003713	0.417	transcription coactivator activity
GO:0019787	0.312	ubiquitin-like protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0006807	0.992	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0019219	0.989	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.988	primary metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0009987	0.986	cellular process
GO:0010468	0.985	regulation of gene expression
GO:0048522	0.984	positive regulation of cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0043412	0.970	macromolecule modification
GO:0051128	0.947	regulation of cellular component organization
GO:1902275	0.925	regulation of chromatin organization
GO:0009892	0.923	negative regulation of metabolic process
GO:0033044	0.905	regulation of chromosome organization
GO:0048523	0.904	negative regulation of cellular process
GO:0010556	0.892	regulation of macromolecule biosynthetic process
GO:0120261	0.891	regulation of heterochromatin organization
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0050896	0.878	response to stimulus
GO:0051252	0.876	regulation of RNA metabolic process
GO:0010605	0.872	negative regulation of macromolecule metabolic process
GO:0009893	0.865	positive regulation of metabolic process
GO:2001141	0.864	regulation of RNA biosynthetic process
GO:0044237	0.863	cellular metabolic process
GO:0031324	0.854	negative regulation of cellular metabolic process
GO:0051172	0.848	negative regulation of nitrogen compound metabolic process
GO:0051130	0.837	positive regulation of cellular component organization
GO:1901564	0.826	organonitrogen compound metabolic process
GO:2001252	0.826	positive regulation of chromosome organization
GO:0031445	0.803	regulation of heterochromatin formation
GO:0031325	0.779	positive regulation of cellular metabolic process
GO:0051173	0.752	positive regulation of nitrogen compound metabolic process
GO:0034641	0.743	cellular nitrogen compound metabolic process
GO:0019538	0.723	protein metabolic process
GO:0046483	0.721	heterocycle metabolic process
GO:0045934	0.719	negative regulation of nucleobase-containing compound metabolic process
GO:1901360	0.718	organic cyclic compound metabolic process
GO:0010604	0.718	positive regulation of macromolecule metabolic process
GO:0006355	0.717	regulation of DNA-templated transcription
GO:0006725	0.711	cellular aromatic compound metabolic process
GO:0006139	0.700	nucleobase-containing compound metabolic process
GO:0036211	0.693	protein modification process
GO:0065009	0.678	regulation of molecular function
GO:0090304	0.653	nucleic acid metabolic process
GO:0051253	0.595	negative regulation of RNA metabolic process
GO:0031327	0.593	negative regulation of cellular biosynthetic process
GO:0045935	0.549	positive regulation of nucleobase-containing compound metabolic process
GO:0010558	0.542	negative regulation of macromolecule biosynthetic process
GO:0044093	0.523	positive regulation of molecular function
GO:0051098	0.508	regulation of binding
GO:0045892	0.502	negative regulation of DNA-templated transcription
GO:0044260	0.499	cellular macromolecule metabolic process
GO:0006950	0.480	response to stress
GO:0002376	0.462	immune system process
GO:0051716	0.392	cellular response to stimulus
GO:0051052	0.388	regulation of DNA metabolic process
GO:0006259	0.385	DNA metabolic process
GO:0009607	0.380	response to biotic stimulus
GO:0051099	0.342	positive regulation of binding
GO:0009605	0.311	response to external stimulus
GO:0044419	0.308	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0005829	0.779	cytosol
GO:0005694	0.668	chromosome
GO:0140513	0.610	nuclear protein-containing complex
GO:0000785	0.356	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]