StarFunc result for job id Q13275

User Input

>input (785 residues)
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTIAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSMSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
HPPDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q5T8	0.859	0.853	0.000	791	0.683	0.678	A0A2R8Q5T8.pdb.gz	A0A2R8Q5T8_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
2	AFDB:A0A2R8QBF0	0.825	0.850	0.000	761	0.675	0.696	A0A2R8QBF0.pdb.gz
3	AFDB:A0A2R8QJ63	0.816	0.831	0.000	771	0.671	0.684	A0A2R8QJ63.pdb.gz
4	AFDB:A0A2R9YJJ7	0.827	0.870	0.000	746	0.573	0.603	A0A2R9YJJ7.pdb.gz
5	AFDB:A1L5C9	0.826	0.866	0.000	749	0.561	0.587	A1L5C9.pdb.gz
6	AFDB:F1QPG9	0.870	0.853	0.000	801	0.683	0.669	F1QPG9.pdb.gz
7	AFDB:O88632	0.919	0.919	0.000	785	0.953	0.953	O88632.pdb.gz	SEM3F_MOUSE Semaphorin-3F OS=Mus musculus OX=10090 GN=Sema3f PE=2 SV=2
8	AFDB:A0A1D5PZ68	0.809	0.845	8.702E-101	751	0.502	0.525	A0A1D5PZ68.pdb.gz	A0A1D5PZ68_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=3 SV=1
9	AFDB:Q62181	0.810	0.847	1.327E-100	751	0.501	0.523	Q62181.pdb.gz	SEM3C_MOUSE Semaphorin-3C OS=Mus musculus OX=10090 GN=Sema3c PE=1 SV=2
10	AFDB:O08665	0.822	0.835	3.197E-98	772	0.460	0.468	O08665.pdb.gz	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
11	PDB:6qp7A	0.654	0.819	6.165E-53	620	0.245	0.310	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.640	0.839	8.479E-41	588	0.210	0.281	3nvqA.pdb.gz
13	PDB:3nvnA	0.430	0.836	3.792E-21	383	0.101	0.206	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.379	0.397	1.090E-14	747	0.116	0.122	6vxkB.pdb.gz
15	PDB:6jp6A	0.194	0.159	6.910E-8	998	0.084	0.066	6jp6A.pdb.gz
16	PDB:5y31B	0.262	0.373	9.156E-7	511	0.052	0.080	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
17	PDB:7mq8LH	0.182	0.189	2.629E-6	746	0.071	0.075	7mq8LH.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7wb4c	0.280	0.555	3.079E-6	346	0.054	0.121	7wb4c.pdb.gz
19	PDB:7dvq3	0.094	0.073	4.225E-6	1193	0.070	0.046	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7ajuUL	0.195	0.196	7.160E-6	779	0.057	0.058	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PZ68	844	751	0.507	0.530	A0A1D5PZ68_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=3 SV=1
2	A0A2R8Q5T8	1123	791	0.689	0.684	A0A2R8Q5T8_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
3	E7F6C0	1129	787	0.689	0.687	E7F6C0_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Fb OS=Danio rerio OX=7955 GN=sema3fb PE=3 SV=1
4	F1NVZ5	737	808	0.465	0.452	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
5	M9MM97	679	771	0.443	0.451	M9MM97_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3bl OS=Danio rerio OX=7955 GN=fc22d04 PE=3 SV=1
6	O08665	749	772	0.468	0.475	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
7	O15041	666	775	0.424	0.430	SEM3E_HUMAN Semaphorin-3E OS=Homo sapiens OX=9606 GN=SEMA3E PE=1 SV=1
8	O42236	840	751	0.506	0.529	SEM3C_CHICK Semaphorin-3C OS=Gallus gallus OX=9031 GN=SEMA3C PE=2 SV=1
9	O42237	658	785	0.419	0.419	SEM3E_CHICK Semaphorin-3E OS=Gallus gallus OX=9031 GN=SEMA3E PE=2 SV=1
10	O88632	1524	785	0.959	0.959	SEM3F_MOUSE Semaphorin-3F OS=Mus musculus OX=10090 GN=Sema3f PE=2 SV=2
11	P70275	676	775	0.415	0.421	SEM3E_MOUSE Semaphorin-3E OS=Mus musculus OX=10090 GN=Sema3e PE=1 SV=3
12	Q13214	662	749	0.446	0.467	SEM3B_HUMAN Semaphorin-3B OS=Homo sapiens OX=9606 GN=SEMA3B PE=1 SV=1
13	Q13275	1636	785	1.000	1.000	SEM3F_HUMAN Semaphorin-3F OS=Homo sapiens OX=9606 GN=SEMA3F PE=2 SV=2
14	Q14563	748	771	0.470	0.479	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
15	Q1LYS1	629	768	0.401	0.410	Q1LYS1_DANRE Sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E OS=Danio rerio OX=7955 GN=fj37c11 PE=3 SV=1
16	Q4LFA9	610	780	0.414	0.417	SEM3G_MOUSE Semaphorin-3G OS=Mus musculus OX=10090 GN=Sema3g PE=2 SV=1
17	Q62181	854	751	0.512	0.535	SEM3C_MOUSE Semaphorin-3C OS=Mus musculus OX=10090 GN=Sema3c PE=1 SV=2
18	Q63548	749	772	0.468	0.475	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
19	Q8BH34	720	777	0.442	0.447	SEM3D_MOUSE Semaphorin-3D OS=Mus musculus OX=10090 GN=Sema3d PE=1 SV=1
20	Q90607	740	772	0.465	0.473	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.32	22.4	Immunoglobulin I-set domain
2	PF00047 ig	2.4	19.7	Immunoglobulin domain
3	PF13895 Ig_2	7.8	18.2	Immunoglobulin domain
4	PF13927 Ig_3	0.27	23.2	Immunoglobulin domain
5	PF18452 Ig_6	3	19.1	Immunoglobulin domain
6	PF01437 PSI	12	17.8	Plexin repeat
7	PF01403 Sema	1.9e-63	225.1	Sema domain
8	PF07686 V-set	12	17.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000002829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.998	Neuropilin-1
2	9606.ENSP00000353582	0.995	Neuropilin-2
3	9606.ENSP00000442736	0.991	Plexin-B3
4	9606.ENSP00000258526	0.973	Plexin-C1
5	9606.ENSP00000377061	0.973	Plexin-A1
6	9606.ENSP00000358696	0.971	Plexin-A3
7	9606.ENSP00000351338	0.949	Plexin-B1
8	9606.ENSP00000317128	0.893	Plexin-D1
9	9606.ENSP00000409171	0.893	Plexin-B2
10	9606.ENSP00000478570	0.889	Vascular endothelial growth factor A
11	9606.ENSP00000173229	0.707	Netrin-1
12	9606.ENSP00000374323	0.703	Ephrin type-A receptor 6
13	9606.ENSP00000332164	0.620	Slit homolog 3 protein
14	9606.ENSP00000417335	0.618	Roundabout homolog 2
15	9606.ENSP00000275815	0.614	Ephrin type-A receptor 1
16	9606.ENSP00000376753	0.594	PDZ domain-containing protein GIPC1
17	9606.ENSP00000341189	0.581	Focal adhesion kinase 1
18	9606.ENSP00000337838	0.561	Reticulon-4
19	9606.ENSP00000356000	0.561	Plexin-A2
20	9606.ENSP00000266058	0.559	Slit homolog 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.999	receptor ligand activity
GO:0038191	0.975	neuropilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.995	response to stimulus
GO:0032501	0.995	multicellular organismal process
GO:0048731	0.986	system development
GO:0040011	0.983	locomotion
GO:0007399	0.975	nervous system development
GO:0048812	0.973	neuron projection morphogenesis
GO:0048667	0.972	cell morphogenesis involved in neuron differentiation
GO:0006935	0.968	chemotaxis
GO:0007411	0.963	axon guidance
GO:0065007	0.909	biological regulation
GO:0050794	0.887	regulation of cellular process
GO:0007154	0.848	cell communication
GO:0051716	0.843	cellular response to stimulus
GO:0023052	0.792	signaling
GO:0007165	0.709	signal transduction
GO:0016477	0.616	cell migration
GO:0048513	0.471	animal organ development
GO:0048519	0.464	negative regulation of biological process
GO:0007166	0.451	cell surface receptor signaling pathway
GO:0048523	0.442	negative regulation of cellular process
GO:0048583	0.437	regulation of response to stimulus
GO:0051239	0.429	regulation of multicellular organismal process
GO:0040012	0.429	regulation of locomotion
GO:0048518	0.427	positive regulation of biological process
GO:0051128	0.425	regulation of cellular component organization
GO:0050793	0.389	regulation of developmental process
GO:0048522	0.362	positive regulation of cellular process
GO:0009888	0.318	tissue development
GO:0001667	0.317	ameboidal-type cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.954	cell periphery
GO:0043226	0.709	organelle
GO:0005622	0.674	intracellular anatomical structure
GO:0043227	0.638	membrane-bounded organelle
GO:0043229	0.587	intracellular organelle
GO:0005737	0.469	cytoplasm
GO:0070013	0.424	intracellular organelle lumen
GO:0005886	0.400	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]