StarFunc result for job id Q13285

User Input

>input (461 residues)
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33242	0.537	0.536	3.466E-56	462	0.937	0.935	P33242.pdb.gz	STF1_MOUSE Steroidogenic factor 1 OS=Mus musculus OX=10090 GN=Nr5a1 PE=1 SV=3
2	AFDB:F1DAM0	0.434	0.473	2.225E-43	421	0.913	1.000	F1DAM0.pdb.gz	F1DAM0_HUMAN Nuclear receptor subfamily 5 group A member 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
3	AFDB:O00482	0.628	0.547	2.225E-42	541	0.620	0.529	O00482.pdb.gz	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
4	AFDB:Q90YL6	0.675	0.609	2.541E-41	517	0.631	0.563	Q90YL6.pdb.gz	Q90YL6_DANRE Nr5a2 protein OS=Danio rerio OX=7955 GN=zFF1 PE=2 SV=1
5	AFDB:P45448	0.513	0.423	3.784E-41	560	0.590	0.486	P45448.pdb.gz	NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 OS=Mus musculus OX=10090 GN=Nr5a2 PE=1 SV=3
6	AFDB:F1QJG0	0.560	0.568	4.322E-39	454	0.568	0.577	F1QJG0.pdb.gz	F1QJG0_DANRE Nuclear receptor subfamily 5, group A, member 1a OS=Danio rerio OX=7955 GN=SF1-A PE=3 SV=1
7	AFDB:B3DKN2	0.547	0.482	2.128E-35	537	0.505	0.434	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
8	AFDB:Q5T6F7	0.511	0.954	8.394E-29	245	0.505	0.951	Q5T6F7.pdb.gz	Q5T6F7_HUMAN Nuclear receptor subfamily 5 group A member 1 (Fragment) OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
9	AFDB:P33244	0.456	0.212	2.035E-27	1027	0.419	0.188	P33244.pdb.gz	FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosophila melanogaster OX=7227 GN=ftz-f1 PE=1 SV=2
10	AFDB:Q05192	0.459	0.268	1.250E-21	808	0.312	0.178	Q05192.pdb.gz	FTF1B_DROME Nuclear hormone receptor FTZ-F1 beta OS=Drosophila melanogaster OX=7227 GN=Hr39 PE=1 SV=3
11	PDB:3dzyA	0.403	0.605	2.096E-15	302	0.241	0.368	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.376	0.687	1.127E-8	246	0.121	0.228	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.397	0.734	3.564E-8	238	0.113	0.218	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.387	0.666	2.289E-6	259	0.102	0.181	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:4o9yA	0.081	0.020	1.834E-1	2490	0.089	0.016	4o9yA.pdb.gz
16	PDB:7p5jA	0.088	0.097	2.289E-1	399	0.082	0.095	7p5jA.pdb.gz
17	PDB:7p5cA	0.087	0.100	2.500E-1	392	0.067	0.079	7p5cA.pdb.gz
18	PDB:7oqzA	0.129	0.198	3.725E-1	237	0.069	0.135	7oqzA.pdb.gz
19	PDB:1ekuB	0.104	0.171	6.923E-1	254	0.065	0.118	1ekuB.pdb.gz
20	PDB:7b93H	0.138	0.175	6.923E-1	318	0.050	0.072	7b93H.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1D8R8	0.0	948	461	1.000	1.000	F1D8R8_HUMAN Steroidogenic factor 1 nuclear receptor OS=Homo sapiens OX=9606 GN=NR5A1 PE=2 SV=1
2	F1DAM0	0.0	844	421	0.913	1.000	F1DAM0_HUMAN Nuclear receptor subfamily 5 group A member 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
3	O00482	0.0	574	541	0.625	0.532	NR5A2_HUMAN Nuclear receptor subfamily 5 group A member 2 OS=Homo sapiens OX=9606 GN=NR5A2 PE=1 SV=2
4	P33242	0.0	820	462	0.937	0.935	STF1_MOUSE Steroidogenic factor 1 OS=Mus musculus OX=10090 GN=Nr5a1 PE=1 SV=3
5	P45448	0.0	545	560	0.599	0.493	NR5A2_MOUSE Nuclear receptor subfamily 5 group A member 2 OS=Mus musculus OX=10090 GN=Nr5a2 PE=1 SV=3
6	P50569	0.0	822	462	0.939	0.937	STF1_RAT Steroidogenic factor 1 OS=Rattus norvegicus OX=10116 GN=Nr5a1 PE=3 SV=1
7	Q04752	0.0	819	461	0.950	0.950	STF1_BOVIN Steroidogenic factor 1 OS=Bos taurus OX=9913 GN=NR5A1 PE=1 SV=1
8	Q13285	0.0	948	461	1.000	1.000	STF1_HUMAN Steroidogenic factor 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=2
9	Q90YL6	0.0	566	517	0.633	0.565	Q90YL6_DANRE Nr5a2 protein OS=Danio rerio OX=7955 GN=zFF1 PE=2 SV=1
10	Q9QWM1	0.0	548	560	0.603	0.496	NR5A2_RAT Nuclear receptor subfamily 5 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr5a2 PE=2 SV=1
11	F1QJG0	6.23e-170	487	454	0.570	0.579	F1QJG0_DANRE Nuclear receptor subfamily 5, group A, member 1a OS=Danio rerio OX=7955 GN=SF1-A PE=3 SV=1
12	Q5T6F7	1.38e-168	475	245	0.503	0.947	Q5T6F7_HUMAN Nuclear receptor subfamily 5 group A member 1 (Fragment) OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=1
13	Q9IAI9	1.39e-167	481	454	0.568	0.577	Q9IAI9_DANRE Ff1b OS=Danio rerio OX=7955 GN=ff1b PE=2 SV=1
14	F1QKV6	7.64e-144	423	511	0.525	0.474	F1QKV6_DANRE Nuclear receptor subfamily 5, group A, member 5 OS=Danio rerio OX=7955 GN=fd46g06 PE=3 SV=1
15	B3DKN2	1.43e-143	423	537	0.525	0.451	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
16	P33244	5.17e-55	199	1027	0.210	0.094	FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosophila melanogaster OX=7227 GN=ftz-f1 PE=1 SV=2
17	Q19345	3.65e-49	178	572	0.163	0.131	NHR25_CAEEL Nuclear hormone receptor family member nhr-25 OS=Caenorhabditis elegans OX=6239 GN=nhr-25 PE=1 SV=1
18	P70033	1.31e-41	155	435	0.247	0.262	NR6A1_XENLA Nuclear receptor subfamily 6 group A member 1 OS=Xenopus laevis OX=8355 GN=nr6a1 PE=1 SV=2
19	Q64249	5.92e-41	154	495	0.252	0.234	NR6A1_MOUSE Nuclear receptor subfamily 6 group A member 1 OS=Mus musculus OX=10090 GN=Nr6a1 PE=1 SV=1
20	Q15406	2.12e-40	152	480	0.254	0.244	NR6A1_HUMAN Nuclear receptor subfamily 6 group A member 1 OS=Homo sapiens OX=9606 GN=NR6A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	6.8e-21	86.4	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.8e-28	110.1	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362690

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368253	0.999	Nuclear receptor subfamily 0 group B member 1
2	9606.ENSP00000344456	0.991	Catenin beta-1
3	9606.ENSP00000334458	0.988	Transcription factor GATA-4
4	9606.ENSP00000221496	0.975	Muellerian-inhibiting factor
5	9606.ENSP00000245479	0.972	Transcription factor SOX-9
6	9606.ENSP00000331327	0.942	Wilms tumor protein
7	9606.ENSP00000399968	0.942	Nuclear receptor coactivator 2
8	9606.ENSP00000348056	0.939	SUMO-conjugating enzyme UBC9
9	9606.ENSP00000249636	0.929	E3 SUMO-protein ligase PIAS1
10	9606.ENSP00000405965	0.927	Small ubiquitin-related modifier 2
11	9606.ENSP00000376765	0.903	E3 SUMO-protein ligase PIAS3
12	9606.ENSP00000239938	0.894	Early growth response protein 1
13	9606.ENSP00000264867	0.892	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
14	9606.ENSP00000371711	0.890	Doublesex- and mab-3-related transcription factor 1
15	9606.ENSP00000376077	0.876	Small ubiquitin-related modifier 1
16	9606.ENSP00000265340	0.875	Pituitary homeobox 1
17	9606.ENSP00000268053	0.867	Cholesterol side-chain cleavage enzyme, mitochondrial
18	9606.ENSP00000266991	0.865	Desert hedgehog protein
19	9606.ENSP00000276449	0.861	Steroidogenic acute regulatory protein, mitochondrial
20	9606.ENSP00000254227	0.846	Nuclear receptor subfamily 0 group B member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0003677	0.999	DNA binding
GO:0005515	0.997	protein binding
GO:0043565	0.988	sequence-specific DNA binding
GO:0003690	0.979	double-stranded DNA binding
GO:0000981	0.969	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.907	sequence-specific double-stranded DNA binding
GO:0000978	0.878	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0038023	0.580	signaling receptor activity
GO:0008134	0.509	transcription factor binding
GO:0098531	0.309	ligand-activated transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.991	positive regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0032502	0.975	developmental process
GO:0022414	0.971	reproductive process
GO:0010557	0.960	positive regulation of macromolecule biosynthetic process
GO:0045935	0.956	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.954	positive regulation of cellular biosynthetic process
GO:0009987	0.945	cellular process
GO:0032501	0.932	multicellular organismal process
GO:0048856	0.924	anatomical structure development
GO:0061458	0.900	reproductive system development
GO:0051254	0.846	positive regulation of RNA metabolic process
GO:0045893	0.827	positive regulation of DNA-templated transcription
GO:0008406	0.825	gonad development
GO:0006357	0.695	regulation of transcription by RNA polymerase II
GO:0045944	0.633	positive regulation of transcription by RNA polymerase II
GO:0051239	0.597	regulation of multicellular organismal process
GO:0050896	0.464	response to stimulus
GO:0008152	0.425	metabolic process
GO:0071704	0.372	organic substance metabolic process
GO:0048519	0.360	negative regulation of biological process
GO:0051716	0.332	cellular response to stimulus
GO:0044238	0.331	primary metabolic process
GO:0008585	0.307	female gonad development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.979	cytosol
GO:0032991	0.410	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]