StarFunc result for job id Q13287

User Input

>input (307 residues)
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQI
KEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVS
MSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELS
FSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTE
IHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQP
HIAYFEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13287	1.000	1.000	5.926E-58	307	1.000	1.000	Q13287.pdb.gz	NMI_HUMAN N-myc-interactor OS=Homo sapiens OX=9606 GN=NMI PE=1 SV=2
2	AFDB:O35309	0.799	0.783	2.472E-44	314	0.622	0.608	O35309.pdb.gz	NMI_MOUSE N-myc-interactor OS=Mus musculus OX=10090 GN=Nmi PE=1 SV=1
3	AFDB:Q9D8C4	0.371	0.394	8.524E-23	286	0.248	0.266	Q9D8C4.pdb.gz	IN35_MOUSE Interferon-induced 35 kDa protein homolog OS=Mus musculus OX=10090 GN=Ifi35 PE=1 SV=3
4	AFDB:P80217	0.375	0.399	1.328E-22	286	0.270	0.290	P80217.pdb.gz	IN35_HUMAN Interferon-induced 35 kDa protein OS=Homo sapiens OX=9606 GN=IFI35 PE=1 SV=5
5	AFDB:Q6ZSC3	0.242	0.210	1.038E-5	357	0.065	0.056	Q6ZSC3.pdb.gz	RBM43_HUMAN RNA-binding protein 43 OS=Homo sapiens OX=9606 GN=RBM43 PE=1 SV=1
6	AFDB:Q2EMV9	0.225	0.041	4.385E-5	1817	0.111	0.019	Q2EMV9.pdb.gz	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
7	AFDB:Q460N5	0.232	0.043	5.785E-5	1801	0.127	0.022	Q460N5.pdb.gz	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
8	AFDB:D0VWM8	0.210	0.163	5.929E-4	414	0.098	0.072	D0VWM8.pdb.gz	TADBP_CAEEL Tar DNA-binding protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=tdp-1 PE=1 SV=1
9	AFDB:Q8TDB6	0.220	0.096	1.699E-3	740	0.068	0.028	Q8TDB6.pdb.gz	DTX3L_HUMAN E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1
10	PDB:6ff7X	0.215	0.372	4.113E-3	171	0.049	0.088	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	PDB:3pgwP	0.213	0.532	8.452E-3	113	0.049	0.133	3pgwP.pdb.gz
12	PDB:5gm6R	0.234	0.271	8.934E-3	261	0.046	0.054	5gm6R.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	AFDB:Q8IP90	0.180	0.079	8.957E-3	810	0.088	0.033	Q8IP90.pdb.gz	Q8IP90_DROME Bruno 1, isoform B OS=Drosophila melanogaster OX=7227 GN=bru1 PE=2 SV=1
14	PDB:6exnY	0.210	0.633	1.317E-2	87	0.062	0.218	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
15	PDB:3lqvB	0.182	0.426	2.051E-2	115	0.036	0.096	3lqvB.pdb.gz	Branch Recognition by SF3b14
16	PDB:3jb9k	0.201	0.621	2.560E-2	89	0.046	0.157	3jb9k.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
17	PDB:5xjcw	0.167	0.459	2.560E-2	91	0.042	0.143	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:6qx91K	0.185	0.269	4.455E-2	201	0.052	0.080	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7ohxo	0.186	0.457	5.561E-2	112	0.042	0.116	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
20	PDB:7a09B	0.204	0.123	5.878E-2	536	0.046	0.026	7a09B.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13287	0.0	625	307	1.000	1.000	NMI_HUMAN N-myc-interactor OS=Homo sapiens OX=9606 GN=NMI PE=1 SV=2
2	O35309	3.34e-141	402	314	0.648	0.634	NMI_MOUSE N-myc-interactor OS=Mus musculus OX=10090 GN=Nmi PE=1 SV=1
3	P80217	1.42e-27	110	286	0.248	0.266	IN35_HUMAN Interferon-induced 35 kDa protein OS=Homo sapiens OX=9606 GN=IFI35 PE=1 SV=5
4	Q9D8C4	1.00e-24	102	286	0.251	0.269	IN35_MOUSE Interferon-induced 35 kDa protein homolog OS=Mus musculus OX=10090 GN=Ifi35 PE=1 SV=3
5	O95398	0.18	36.2	923	0.052	0.017	RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=RAPGEF3 PE=1 SV=6
6	Q460N5	0.32	35.4	1801	0.068	0.012	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
7	Q2EMV9	0.58	34.7	1817	0.065	0.011	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
8	P50362	3.2	32.0	374	0.046	0.037	G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=GAPA PE=1 SV=1
9	O13985	3.8	31.6	512	0.124	0.074	YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.03 PE=1 SV=2
10	F4J1U4	4.7	31.6	1263	0.039	0.010	KN12E_ARATH Kinesin-like protein KIN-12E OS=Arabidopsis thaliana OX=3702 GN=KIN12E PE=3 SV=1
11	Q5LLW7	4.8	31.6	588	0.059	0.031	DMDC_RUEPO 3-methylmercaptopropionyl-CoA dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=dmdC PE=1 SV=1
12	Q6ZSC3	8.0	30.4	357	0.055	0.048	RBM43_HUMAN RNA-binding protein 43 OS=Homo sapiens OX=9606 GN=RBM43 PE=1 SV=1
13	Q5JSH3	8.5	30.8	913	0.078	0.026	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
14	P01120	9.0	30.4	322	0.055	0.053	RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAS2 PE=1 SV=4
15	G5EAY1	9.3	30.8	1474	0.062	0.013	G5EAY1_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=teaA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07716 bZIP_2	9.7e+02	11.3	Basic region leucine zipper
2	PF07989 Cnn_1N	18	16.9	Centrosomin N-terminal motif 1
3	PF07334 IFP_35_N	1.8e-36	135.4	Interferon-induced 35 kDa protein (IFP 35) N-terminus
4	PF07292 NID	5e-62	217.7	Nmi/IFP 35 domain (NID)
5	PF09032 Siah-Interact_N	1.2e+02	14.4	Siah interacting protein, N terminal
6	PF03721 UDPG_MGDP_dh_N	4.9e+02	11.7	UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395590	0.989	Interferon-induced 35 kDa protein
2	9606.ENSP00000293328	0.983	Signal transducer and activator of transcription 5B
3	9606.ENSP00000479618	0.948	Myc proto-oncogene protein
4	9606.ENSP00000341208	0.942	Signal transducer and activator of transcription 5A
5	9606.ENSP00000281043	0.936	N-myc proto-oncogene protein
6	9606.ENSP00000262367	0.928	CREB-binding protein
7	9606.ENSP00000263253	0.926	Histone acetyltransferase p300
8	9606.ENSP00000226730	0.923	Interleukin-2
9	9606.ENSP00000391676	0.915	Tyrosine-protein kinase JAK3
10	9606.ENSP00000343204	0.908	Tyrosine-protein kinase JAK1
11	9606.ENSP00000363318	0.908	Cytokine receptor common subunit gamma
12	9606.ENSP00000256897	0.905	Cyclin-H
13	9606.ENSP00000369293	0.905	Interleukin-2 receptor subunit alpha
14	9606.ENSP00000329418	0.904	Suppressor of cytokine signaling 1
15	9606.ENSP00000347979	0.904	Tumor necrosis factor receptor superfamily member 6
16	9606.ENSP00000302564	0.903	Bcl-2-like protein 1
17	9606.ENSP00000391592	0.903	Tyrosine-protein phosphatase non-receptor type 6
18	9606.ENSP00000227507	0.902	G1/S-specific cyclin-D1
19	9606.ENSP00000261254	0.901	G1/S-specific cyclin-D2
20	9606.ENSP00000216223	0.900	Interleukin-2 receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:1901363	0.425	heterocyclic compound binding
GO:0097159	0.425	organic cyclic compound binding
GO:0003676	0.324	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0048519	0.976	negative regulation of biological process
GO:0048522	0.976	positive regulation of cellular process
GO:0051716	0.975	cellular response to stimulus
GO:0007166	0.972	cell surface receptor signaling pathway
GO:0002376	0.967	immune system process
GO:0048583	0.959	regulation of response to stimulus
GO:0048523	0.957	negative regulation of cellular process
GO:0050777	0.935	negative regulation of immune response
GO:0045824	0.923	negative regulation of innate immune response
GO:0042116	0.912	macrophage activation
GO:0009966	0.906	regulation of signal transduction
GO:1902532	0.889	negative regulation of intracellular signal transduction
GO:0048584	0.882	positive regulation of response to stimulus
GO:0006955	0.871	immune response
GO:0097696	0.865	receptor signaling pathway via STAT
GO:0007259	0.855	receptor signaling pathway via JAK-STAT
GO:0009967	0.835	positive regulation of signal transduction
GO:0019222	0.825	regulation of metabolic process
GO:1901222	0.793	regulation of NIK/NF-kappaB signaling
GO:0042127	0.780	regulation of cell population proliferation
GO:0060255	0.778	regulation of macromolecule metabolic process
GO:0080090	0.758	regulation of primary metabolic process
GO:0051171	0.758	regulation of nitrogen compound metabolic process
GO:0002366	0.729	leukocyte activation involved in immune response
GO:1902533	0.705	positive regulation of intracellular signal transduction
GO:1901224	0.682	positive regulation of NIK/NF-kappaB signaling
GO:0002275	0.673	myeloid cell activation involved in immune response
GO:0031323	0.658	regulation of cellular metabolic process
GO:0008285	0.564	negative regulation of cell population proliferation
GO:0071704	0.486	organic substance metabolic process
GO:0044238	0.471	primary metabolic process
GO:0006807	0.440	nitrogen compound metabolic process
GO:0009893	0.419	positive regulation of metabolic process
GO:0010468	0.400	regulation of gene expression
GO:0010604	0.396	positive regulation of macromolecule metabolic process
GO:0051173	0.392	positive regulation of nitrogen compound metabolic process
GO:0043170	0.387	macromolecule metabolic process
GO:0051246	0.376	regulation of protein metabolic process
GO:0009892	0.363	negative regulation of metabolic process
GO:0010605	0.352	negative regulation of macromolecule metabolic process
GO:0002684	0.332	positive regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005615	0.999	extracellular space
GO:0005654	0.999	nucleoplasm
GO:0016020	0.995	membrane
GO:0071944	0.326	cell periphery
GO:0005886	0.302	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]