StarFunc result for job id Q13291

User Input

>input (335 residues)
MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13291	1.000	1.000	2.537E-58	335	1.000	1.000	Q13291.pdb.gz	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1
2	AFDB:Q9QUM4	0.705	0.691	1.053E-39	343	0.618	0.603	Q9QUM4.pdb.gz	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
3	AFDB:Q07763	0.486	0.420	2.276E-18	397	0.230	0.194	Q07763.pdb.gz	CD244_MOUSE Natural killer cell receptor 2B4 OS=Mus musculus OX=10090 GN=Cd244 PE=1 SV=3
4	AFDB:Q9BZW8	0.393	0.364	2.676E-18	370	0.215	0.195	Q9BZW8.pdb.gz	CD244_HUMAN Natural killer cell receptor 2B4 OS=Homo sapiens OX=9606 GN=CD244 PE=1 SV=2
5	AFDB:Q9P0V8	0.489	0.565	2.870E-17	285	0.176	0.207	Q9P0V8.pdb.gz	SLAF8_HUMAN SLAM family member 8 OS=Homo sapiens OX=9606 GN=SLAMF8 PE=1 SV=1
6	AFDB:Q9UIB8	0.477	0.467	4.664E-17	345	0.191	0.186	Q9UIB8.pdb.gz	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
7	AFDB:Q01965	0.562	0.304	8.440E-17	654	0.170	0.087	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
8	AFDB:Q9NQ25	0.570	0.570	3.079E-16	335	0.203	0.203	Q9NQ25.pdb.gz	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
9	AFDB:Q9D3G2	0.489	0.580	3.820E-16	278	0.167	0.201	Q9D3G2.pdb.gz	SLAF8_MOUSE SLAM family member 8 OS=Mus musculus OX=10090 GN=Slamf8 PE=2 SV=2
10	AFDB:Q9H6B4	0.476	0.435	5.572E-16	373	0.176	0.158	Q9H6B4.pdb.gz	CLMP_HUMAN CXADR-like membrane protein OS=Homo sapiens OX=9606 GN=CLMP PE=1 SV=1
11	PDB:6vpyL	0.244	0.371	3.373E-9	209	0.101	0.163	6vpyL.pdb.gz
12	PDB:2qhrL	0.276	0.390	1.371E-8	218	0.107	0.165	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
13	PDB:3c2aL	0.239	0.351	1.527E-8	216	0.107	0.167	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
14	PDB:4r2gP	0.252	0.382	1.527E-8	210	0.107	0.171	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
15	PDB:6dldD	0.381	0.462	2.481E-8	269	0.096	0.119	6dldD.pdb.gz
16	PDB:1a8jL	0.261	0.388	4.253E-8	216	0.110	0.171	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
17	PDB:3o3uN	0.328	0.203	4.253E-8	580	0.122	0.071	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:6b9yA	0.237	0.352	5.570E-8	214	0.087	0.136	6b9yA.pdb.gz	Template-Catalyzed, Disulfide Conjugation of Monoclonal Antibodies Using a Natural Amino Acid Tag.
19	PDB:7qpdT	0.257	0.249	5.570E-8	348	0.093	0.089	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.
20	PDB:1kc5L	0.243	0.363	6.910E-8	214	0.093	0.145	1kc5L.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13291	0.0	693	335	1.000	1.000	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1
2	Q9QUM4	1.30e-136	393	343	0.621	0.606	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
3	Q18PI6	7.29e-16	79.3	329	0.224	0.228	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
4	Q9BZW8	2.59e-13	72.4	370	0.176	0.159	CD244_HUMAN Natural killer cell receptor 2B4 OS=Homo sapiens OX=9606 GN=CD244 PE=1 SV=2
5	P10252	2.46e-12	67.8	240	0.137	0.192	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
6	P18181	3.03e-12	67.8	240	0.173	0.242	CD48_MOUSE CD48 antigen OS=Mus musculus OX=10090 GN=Cd48 PE=1 SV=1
7	Q9D3G2	7.13e-12	67.0	278	0.167	0.201	SLAF8_MOUSE SLAM family member 8 OS=Mus musculus OX=10090 GN=Slamf8 PE=2 SV=2
8	Q07763	1.56e-11	67.0	397	0.182	0.154	CD244_MOUSE Natural killer cell receptor 2B4 OS=Mus musculus OX=10090 GN=Cd244 PE=1 SV=3
9	Q9P0V8	5.18e-11	64.7	285	0.104	0.123	SLAF8_HUMAN SLAM family member 8 OS=Homo sapiens OX=9606 GN=SLAMF8 PE=1 SV=1
10	Q01965	7.32e-10	62.4	654	0.296	0.151	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
11	Q9UIB8	9.11e-10	61.6	345	0.152	0.148	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
12	Q9D780	3.68e-09	59.3	285	0.149	0.175	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
13	P09326	1.01e-07	54.3	243	0.134	0.185	CD48_HUMAN CD48 antigen OS=Homo sapiens OX=9606 GN=CD48 PE=1 SV=2
14	Q9NQ25	1.15e-07	55.1	335	0.110	0.110	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
15	Q9ET39	3.28e-07	53.5	351	0.191	0.182	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
16	Q8BHK6	6.43e-07	52.8	333	0.122	0.123	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
17	Q96DU3	1.61e-06	51.6	332	0.236	0.238	SLAF6_HUMAN SLAM family member 6 OS=Homo sapiens OX=9606 GN=SLAMF6 PE=1 SV=3
18	Q5VYH9	3.85e-06	50.8	565	0.182	0.108	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
19	Q96A28	4.41e-06	50.1	289	0.158	0.183	SLAF9_HUMAN SLAM family member 9 OS=Homo sapiens OX=9606 GN=SLAMF9 PE=2 SV=2
20	Q9HBG7	6.75e-06	50.1	655	0.179	0.092	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	14	17.3	Immunoglobulin domain
2	PF13927 Ig_3	0.67	21.9	Immunoglobulin domain
3	PF11465 Receptor_2B4	24	16.6	Natural killer cell receptor 2B4
4	PF06214 SLAM	3.7e-57	203.2	Signaling lymphocytic activation molecule (SLAM) protein
5	PF07686 V-set	1.5e+02	13.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306190

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360181	0.998	SH2 domain-containing protein 1A
2	9606.ENSP00000346671	0.995	Tyrosine-protein kinase Fyn
3	9606.ENSP00000255416	0.988	Myosin-binding protein H
4	9606.ENSP00000340944	0.975	Tyrosine-protein phosphatase non-receptor type 11
5	9606.ENSP00000356906	0.968	SH2 domain-containing protein 1B
6	9606.ENSP00000355231	0.960	Beclin-1
7	9606.ENSP00000356991	0.901	Nectin-4
8	9606.ENSP00000313875	0.878	Membrane cofactor protein
9	9606.ENSP00000378485	0.866	Megakaryocyte-associated tyrosine-protein kinase
10	9606.ENSP00000262039	0.859	Phosphatidylinositol 3-kinase catalytic subunit type 3
11	9606.ENSP00000411355	0.859	Receptor-type tyrosine-protein phosphatase C
12	9606.ENSP00000362680	0.854	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000337825	0.823	Tyrosine-protein kinase Lck
14	9606.ENSP00000288135	0.821	Mast/stem cell growth factor receptor Kit
15	9606.ENSP00000241453	0.795	Receptor-type tyrosine-protein kinase FLT3
16	9606.ENSP00000262262	0.734	Myeloid cell surface antigen CD33
17	9606.ENSP00000310036	0.731	Hematopoietic progenitor cell antigen CD34
18	9606.ENSP00000011653	0.729	T-cell surface glycoprotein CD4
19	9606.ENSP00000264071	0.725	Tubulin beta-4A chain
20	9606.ENSP00000441691	0.719	Integrin alpha-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0042802	1.000	identical protein binding
GO:0004888	0.617	transmembrane signaling receptor activity
GO:0042169	0.567	SH2 domain binding
GO:0003823	0.516	antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.994	cellular process
GO:0048583	0.994	regulation of response to stimulus
GO:0050896	0.993	response to stimulus
GO:0051239	0.993	regulation of multicellular organismal process
GO:0019222	0.992	regulation of metabolic process
GO:0002376	0.988	immune system process
GO:0048522	0.988	positive regulation of cellular process
GO:0023051	0.983	regulation of signaling
GO:0010646	0.982	regulation of cell communication
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0001775	0.976	cell activation
GO:0042127	0.970	regulation of cell population proliferation
GO:0001817	0.970	regulation of cytokine production
GO:0045321	0.966	leukocyte activation
GO:0009966	0.966	regulation of signal transduction
GO:0048584	0.961	positive regulation of response to stimulus
GO:0048519	0.955	negative regulation of biological process
GO:0001818	0.950	negative regulation of cytokine production
GO:0048585	0.911	negative regulation of response to stimulus
GO:0046649	0.901	lymphocyte activation
GO:0048523	0.896	negative regulation of cellular process
GO:0006955	0.892	immune response
GO:0002252	0.889	immune effector process
GO:0080134	0.885	regulation of response to stress
GO:0051716	0.864	cellular response to stimulus
GO:0009967	0.857	positive regulation of signal transduction
GO:0010604	0.855	positive regulation of macromolecule metabolic process
GO:0002682	0.798	regulation of immune system process
GO:1902531	0.779	regulation of intracellular signal transduction
GO:0008284	0.778	positive regulation of cell population proliferation
GO:0002263	0.758	cell activation involved in immune response
GO:1902533	0.676	positive regulation of intracellular signal transduction
GO:0051240	0.658	positive regulation of multicellular organismal process
GO:0043408	0.608	regulation of MAPK cascade
GO:0007154	0.565	cell communication
GO:0002684	0.540	positive regulation of immune system process
GO:0048856	0.539	anatomical structure development
GO:0006950	0.521	response to stress
GO:0023052	0.510	signaling
GO:0007165	0.499	signal transduction
GO:0043410	0.472	positive regulation of MAPK cascade
GO:0002694	0.463	regulation of leukocyte activation
GO:0031323	0.443	regulation of cellular metabolic process
GO:0002366	0.399	leukocyte activation involved in immune response
GO:0050776	0.380	regulation of immune response
GO:1903555	0.369	regulation of tumor necrosis factor superfamily cytokine production
GO:0042221	0.367	response to chemical
GO:0032655	0.362	regulation of interleukin-12 production
GO:0051249	0.348	regulation of lymphocyte activation
GO:0080135	0.345	regulation of cellular response to stress
GO:0023057	0.331	negative regulation of signaling
GO:0080090	0.329	regulation of primary metabolic process
GO:0009968	0.324	negative regulation of signal transduction
GO:0051171	0.322	regulation of nitrogen compound metabolic process
GO:0010628	0.315	positive regulation of gene expression
GO:0065009	0.309	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0031982	0.995	vesicle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005886	0.988	plasma membrane
GO:0005737	0.980	cytoplasm
GO:0005576	0.961	extracellular region
GO:0005615	0.835	extracellular space
GO:0009986	0.819	cell surface
GO:0070062	0.775	extracellular exosome
GO:0031410	0.733	cytoplasmic vesicle
GO:0012505	0.447	endomembrane system
GO:0098552	0.312	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]