StarFunc result for job id Q13303

User Input

>input (367 residues)
MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTF
GGQITDEMAEQLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIF
WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQG
MAMYWGTSRWSSMEIMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGA
MTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLG
CTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHEIDSILGNKPY
SKKDYRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62482	0.967	0.967	8.672E-73	367	0.989	0.989	P62482.pdb.gz	KCAB2_MOUSE Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1
2	AFDB:E9QGU5	0.897	0.799	1.577E-64	412	0.869	0.774	E9QGU5.pdb.gz	E9QGU5_DANRE Voltage-gated potassium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:171453 PE=3 SV=1
3	AFDB:Q14722	0.895	0.784	6.836E-63	419	0.755	0.661	Q14722.pdb.gz	KCAB1_HUMAN Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNAB1 PE=1 SV=1
4	AFDB:P63143	0.890	0.815	1.502E-60	401	0.774	0.708	P63143.pdb.gz	KCAB1_MOUSE Voltage-gated potassium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Kcnab1 PE=1 SV=2
5	PDB:2a79A	0.887	0.998	9.350E-60	326	0.877	0.988	2a79A.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
6	AFDB:O43448	0.879	0.799	9.695E-56	404	0.678	0.616	O43448.pdb.gz	KCAB3_HUMAN Voltage-gated potassium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=KCNAB3 PE=1 SV=2
7	AFDB:E7F8K2	0.812	0.868	3.713E-51	343	0.657	0.703	E7F8K2.pdb.gz
8	AFDB:O23016	0.864	0.965	7.038E-44	328	0.447	0.500	O23016.pdb.gz	KCAB_ARATH Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
9	AFDB:O59826	0.851	0.907	2.976E-40	344	0.414	0.442	O59826.pdb.gz	KCAB_SCHPO Putative voltage-gated potassium channel subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.06 PE=3 SV=1
10	AFDB:M9NEC7	0.796	0.428	4.813E-39	698	0.474	0.249	M9NEC7.pdb.gz	M9NEC7_DROME Hyperkinetic, isoform F OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
11	AFDB:M9PE66	0.779	0.528	2.587E-38	548	0.480	0.321	M9PE66.pdb.gz	M9PE66_DROME Hyperkinetic, isoform K OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
12	PDB:4aubB	0.777	0.849	4.735E-28	335	0.305	0.334	4aubB.pdb.gz	The Diversity of Microbial Aldo/Keto Reductases from Escherichia Coli K12.
13	PDB:4astD	0.741	0.878	6.819E-27	308	0.283	0.338	4astD.pdb.gz
14	PDB:1lqaA	0.780	0.825	3.458E-26	346	0.275	0.292	1lqaA.pdb.gz	Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
15	PDB:1gveA	0.731	0.822	3.890E-19	324	0.210	0.238	1gveA.pdb.gz	The Crystal Structure of Rat Liver Akr7A1: A Dimeric Member of the Aldo-Keto Reductase Superfamily
16	PDB:2c91A	0.727	0.816	8.759E-19	325	0.213	0.240	2c91A.pdb.gz	Crystal Structure of Mouse Succinic Semialdehyde Reductase Akr7A5: Structural Basis for Substrate Specificity.
17	PDB:2clpA	0.738	0.833	1.476E-18	323	0.196	0.223	2clpA.pdb.gz	Crystal Structure of Human Aflatoxin B1 Aldehyde Reductase Member 3
18	PDB:1gveB	0.682	0.822	2.793E-18	301	0.199	0.243	1gveB.pdb.gz	The Crystal Structure of Rat Liver Akr7A1: A Dimeric Member of the Aldo-Keto Reductase Superfamily
19	PDB:4gacA	0.641	0.720	1.261E-17	324	0.193	0.219	4gacA.pdb.gz
20	PDB:3h7rA	0.610	0.719	1.017E-16	307	0.215	0.257	3h7rA.pdb.gz	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QGU5	0.0	652	412	0.853	0.760	E9QGU5_DANRE Voltage-gated potassium channel subunit beta-1 OS=Danio rerio OX=7955 GN=zgc:171453 PE=3 SV=1
2	H0YWU3	0.0	682	398	0.888	0.819	H0YWU3_TAEGU Voltage-gated potassium channel subunit beta-2 OS=Taeniopygia guttata OX=59729 GN=KCNAB2 PE=3 SV=1
3	O43448	0.0	528	404	0.657	0.597	KCAB3_HUMAN Voltage-gated potassium channel subunit beta-3 OS=Homo sapiens OX=9606 GN=KCNAB3 PE=1 SV=2
4	P62482	0.0	754	367	0.989	0.989	KCAB2_MOUSE Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1
5	P62483	0.0	754	367	0.989	0.989	KCAB2_RAT Voltage-gated potassium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Kcnab2 PE=1 SV=1
6	P63143	0.0	605	401	0.768	0.703	KCAB1_MOUSE Voltage-gated potassium channel subunit beta-1 OS=Mus musculus OX=10090 GN=Kcnab1 PE=1 SV=2
7	P63144	0.0	605	401	0.768	0.703	KCAB1_RAT Voltage-gated potassium channel subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Kcnab1 PE=1 SV=1
8	Q13303	0.0	760	367	1.000	1.000	KCAB2_HUMAN Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNAB2 PE=1 SV=2
9	Q14722	0.0	602	419	0.755	0.661	KCAB1_HUMAN Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNAB1 PE=1 SV=1
10	P97382	7.44e-119	346	249	0.422	0.622	KCAB3_MOUSE Voltage-gated potassium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Kcnab3 PE=1 SV=1
11	O23016	2.52e-117	345	328	0.447	0.500	KCAB_ARATH Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
12	M9NGY7	2.82e-116	345	393	0.469	0.438	M9NGY7_DROME Hyperkinetic, isoform I OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
13	M9NF11	2.44e-114	339	374	0.466	0.457	M9NF11_DROME Hyperkinetic, isoform H OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
14	Q9W2W9	8.06e-114	338	392	0.466	0.436	Q9W2W9_DROME HL08167p OS=Drosophila melanogaster OX=7227 GN=Hk PE=2 SV=2
15	Q24052	4.34e-112	339	546	0.466	0.313	Q24052_DROME Hk protein OS=Drosophila melanogaster OX=7227 GN=Hk PE=2 SV=1
16	M9PE66	8.33e-112	338	548	0.466	0.312	M9PE66_DROME Hyperkinetic, isoform K OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
17	Q9W2X0	8.45e-112	338	547	0.466	0.313	Q9W2X0_DROME Hyperkinetic, isoform E OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=3
18	M9PGS8	3.10e-111	338	596	0.466	0.287	M9PGS8_DROME Hyperkinetic, isoform L OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
19	M9NEC7	1.30e-110	340	698	0.466	0.245	M9NEC7_DROME Hyperkinetic, isoform F OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1
20	M9PHI0	5.88e-109	340	887	0.466	0.193	M9PHI0_DROME Hyperkinetic, isoform M OS=Drosophila melanogaster OX=7227 GN=Hk PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	6.1e-59	211.1	Aldo/keto reductase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000000360

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000010223	0.990	Potassium voltage-gated channel, shaker-related subfamily, member 2
2	9555.ENSPANP00000007587	0.962	Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
3	9555.ENSPANP00000009324	0.925	Potassium voltage-gated channel, shaker-related subfamily, member 5
4	9555.ENSPANP00000018474	0.924	RAB28, member RAS oncogene family
5	9555.ENSPANP00000007278	0.918	Potassium voltage-gated channel, shaker-related subfamily, member 4
6	9555.ENSPANP00000001811	0.895	Potassium voltage-gated channel, shaker-related subfamily, member 3
7	9555.ENSPANP00000008974	0.863	Uncharacterized protein
8	9555.ENSPANP00000012815	0.849	Pyridoxal (pyridoxine, vitamin B6) kinase
9	9555.ENSPANP00000017072	0.848	Potassium voltage-gated channel, subfamily H (eag-related), member 5
10	9555.ENSPANP00000007553	0.843	Uncharacterized protein
11	9555.ENSPANP00000000019	0.838	Potassium voltage-gated channel, Shal-related subfamily, member 3
12	9555.ENSPANP00000017045	0.828	Hydroxyacid oxidase (glycolate oxidase) 1
13	9555.ENSPANP00000014627	0.793	Potassium voltage-gated channel, Shab-related subfamily, member 1
14	9555.ENSPANP00000010070	0.763	Potassium voltage-gated channel, shaker-related subfamily, member 7
15	9555.ENSPANP00000019603	0.757	Discs, large homolog 4 (Drosophila)
16	9555.ENSPANP00000009292	0.753	Potassium voltage-gated channel, subfamily F, member 1
17	9555.ENSPANP00000014883	0.749	Potassium voltage-gated channel, Shal-related subfamily, member 1
18	9555.ENSPANP00000007661	0.748	Potassium channel, subfamily V, member 1
19	9555.ENSPANP00000016622	0.746	Potassium voltage-gated channel, Shaw-related subfamily, member 1
20	9555.ENSPANP00000000164	0.741	Potassium voltage-gated channel, Shab-related subfamily, member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015459	1.000	potassium channel regulator activity
GO:0003824	0.951	catalytic activity
GO:0016614	0.930	oxidoreductase activity, acting on CH-OH group of donors
GO:0016616	0.915	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004033	0.829	aldo-keto reductase (NADP) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0050794	0.981	regulation of cellular process
GO:0043266	0.967	regulation of potassium ion transport
GO:0034762	0.960	regulation of transmembrane transport
GO:0034765	0.930	regulation of monoatomic ion transmembrane transport
GO:0009987	0.921	cellular process
GO:1904062	0.895	regulation of monoatomic cation transmembrane transport
GO:1901379	0.584	regulation of potassium ion transmembrane transport
GO:0051179	0.391	localization
GO:0006812	0.361	monoatomic cation transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098796	0.997	membrane protein complex
GO:0042995	0.996	cell projection
GO:0043005	0.990	neuron projection
GO:0034705	0.980	potassium channel complex
GO:0098797	0.970	plasma membrane protein complex
GO:0005737	0.955	cytoplasm
GO:0043226	0.925	organelle
GO:0043227	0.853	membrane-bounded organelle
GO:0030424	0.839	axon
GO:0008076	0.829	voltage-gated potassium channel complex
GO:0044304	0.731	main axon
GO:0098552	0.726	side of membrane
GO:0031234	0.711	extrinsic component of cytoplasmic side of plasma membrane
GO:0043229	0.615	intracellular organelle
GO:0043231	0.567	intracellular membrane-bounded organelle
GO:0031090	0.386	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	0.930	Acting on the CH-OH group of donors.
EC:1.1.1.-	0.915	With NAD(+) or NADP(+) as acceptor.

[back to server]