StarFunc result for job id Q13308

User Input

>input (1070 residues)
MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGP
VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
KERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVVARYE
EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYR
CMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F2R9	0.355	0.358	0.000	1061	0.595	0.600	E7F2R9.pdb.gz
2	AFDB:Q13308	1.000	1.000	0.000	1070	1.000	1.000	Q13308.pdb.gz	PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 PE=1 SV=2
3	AFDB:Q6PA07	0.426	0.435	0.000	1043	0.625	0.641	Q6PA07.pdb.gz	Q6PA07_XENLA MGC68806 protein OS=Xenopus laevis OX=8355 GN=ptk7.L PE=1 SV=1
4	AFDB:Q6AWJ9	0.266	0.275	1.854E-76	1033	0.287	0.297	Q6AWJ9.pdb.gz	PTK7_DROME Tyrosine-protein kinase-like otk OS=Drosophila melanogaster OX=7227 GN=otk PE=1 SV=1
5	AFDB:D2XMV0	0.393	0.677	2.363E-72	594	0.284	0.512	D2XMV0.pdb.gz
6	AFDB:P17948	0.257	0.207	2.373E-65	1338	0.224	0.179	P17948.pdb.gz	VGFR1_HUMAN Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2
7	AFDB:P53767	0.245	0.198	6.784E-65	1336	0.222	0.178	P53767.pdb.gz	VGFR1_RAT Vascular endothelial growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Flt1 PE=2 SV=1
8	AFDB:B3DKP1	0.245	0.208	3.672E-63	1272	0.227	0.191	B3DKP1.pdb.gz	B3DKP1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=VEGFR1 PE=2 SV=1
9	AFDB:Q5GIT4	0.256	0.204	7.659E-63	1357	0.225	0.178	Q5GIT4.pdb.gz	VGFR2_DANRE Vascular endothelial growth factor receptor 2 OS=Danio rerio OX=7955 GN=kdr PE=1 SV=2
10	AFDB:Q8AXB3	0.246	0.203	1.774E-62	1302	0.232	0.190	Q8AXB3.pdb.gz	VGFR4_DANRE Vascular endothelial growth factor receptor kdr-like OS=Danio rerio OX=7955 GN=kdrl PE=1 SV=1
11	PDB:5oj2B	0.189	0.258	3.489E-32	692	0.112	0.173	5oj2B.pdb.gz
12	PDB:1e07A	0.167	0.248	1.896E-23	642	0.097	0.162	1e07A.pdb.gz
13	PDB:2h8hA	0.230	0.528	6.743E-22	445	0.093	0.222	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
14	PDB:4fl2A	0.221	0.414	1.418E-20	555	0.093	0.178	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
15	PDB:4k2rA	0.217	0.412	1.975E-18	551	0.080	0.156	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:1k9aB	0.220	0.521	2.568E-18	441	0.086	0.209	1k9aB.pdb.gz
17	PDB:7sqcO0	0.129	0.123	1.069E-16	1140	0.087	0.082	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6dldD	0.128	0.395	1.627E-16	269	0.060	0.238	6dldD.pdb.gz
19	PDB:6s73A	0.213	0.776	4.942E-15	269	0.059	0.234	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:7q1yA	0.105	0.087	7.522E-15	1374	0.074	0.057	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13308	0.0	2221	1070	1.000	1.000	PTK7_HUMAN Inactive tyrosine-protein kinase 7 OS=Homo sapiens OX=9606 GN=PTK7 PE=1 SV=2
2	Q6PA07	0.0	1367	1043	0.628	0.644	Q6PA07_XENLA MGC68806 protein OS=Xenopus laevis OX=8355 GN=ptk7.L PE=1 SV=1
3	Q8BKG3	0.0	2024	1062	0.904	0.911	PTK7_MOUSE Inactive tyrosine-protein kinase 7 OS=Mus musculus OX=10090 GN=Ptk7 PE=1 SV=1
4	Q502I0	1.01e-68	231	231	0.103	0.476	Q502I0_DANRE Protein tyrosine kinase 7a OS=Danio rerio OX=7955 GN=ptk7a PE=1 SV=1
5	A0A0H2UKW5	1.87e-67	245	813	0.172	0.226	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
6	Q6VNS1	8.87e-66	240	825	0.172	0.223	NTRK3_MOUSE NT-3 growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk3 PE=1 SV=1
7	Q63604	1.79e-64	236	821	0.158	0.206	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
8	P11362	3.08e-64	236	822	0.182	0.237	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
9	P15209	5.73e-64	235	821	0.158	0.206	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
10	F1LSN4	7.38e-64	234	801	0.172	0.230	F1LSN4_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=3
11	P22607	9.20e-64	234	806	0.172	0.228	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1
12	P16092	1.07e-63	234	822	0.182	0.237	FGFR1_MOUSE Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2
13	P21804	1.20e-63	234	819	0.180	0.236	FGFR1_CHICK Fibroblast growth factor receptor 1 OS=Gallus gallus OX=9031 GN=FGFR1 PE=2 SV=1
14	A0A8I5Y7R6	1.87e-63	233	782	0.170	0.233	A0A8I5Y7R6_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=3 SV=1
15	Q16620	3.68e-63	233	822	0.159	0.207	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
16	Q548C2	3.68e-63	233	822	0.159	0.207	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
17	Q04589	4.62e-63	232	822	0.180	0.235	FGFR1_RAT Fibroblast growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Fgfr1 PE=1 SV=1
18	Q9JHX9	7.87e-63	231	800	0.170	0.228	Q9JHX9_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=2 SV=1
19	F1QKJ0	9.22e-63	231	818	0.158	0.207	F1QKJ0_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trkC1 PE=3 SV=2
20	Q6B515	9.82e-63	228	669	0.159	0.254	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	99	14.1	Adenovirus E3 region protein CR1
2	PF06832 BiPBP_C	0.024	26.0	Penicillin-Binding Protein C-terminus Family
3	PF07654 C1-set	0.0058	28.3	Immunoglobulin C1-set domain
4	PF05790 C2-set	16	17.1	Immunoglobulin C2-set domain
5	PF08205 C2-set_2	6.5e-10	50.3	CD80-like C2-set immunoglobulin domain
6	PF07679 I-set	2.6e-80	275.9	Immunoglobulin I-set domain
7	PF00047 ig	1e-47	171.5	Immunoglobulin domain
8	PF13895 Ig_2	2.2e-63	221.9	Immunoglobulin domain
9	PF13927 Ig_3	5.2e-85	291.4	Immunoglobulin domain
10	PF16680 Ig_4	0.041	25.8	T-cell surface glycoprotein CD3 delta chain
11	PF16681 Ig_5	8.7e-09	47.0	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
12	PF18452 Ig_6	1.5e-07	42.8	Immunoglobulin domain
13	PF16706 Izumo-Ig	3.2e-06	38.3	Izumo-like Immunoglobulin domain
14	PF00069 Pkinase	1.8e-36	137.5	Protein kinase domain
15	PF07714 PK_Tyr_Ser-Thr	7.3e-80	279.6	Protein tyrosine and serine/threonine kinase
16	PF07686 V-set	1.1e-24	98.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000031080

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000021905	0.892	Uncharacterized protein
2	9598.ENSPTRP00000051074	0.838	Protein Wnt
3	9598.ENSPTRP00000002604	0.837	VANGL planar cell polarity protein 2
4	9598.ENSPTRP00000055553	0.836	Segment polarity protein dishevelled homolog DVL-1
5	9598.ENSPTRP00000028819	0.832	Uncharacterized protein
6	9598.ENSPTRP00000061336	0.806	Tyrosine-protein phosphatase non-receptor type
7	9598.ENSPTRP00000015928	0.766	Uncharacterized protein
8	9598.ENSPTRP00000008035	0.765	Low-density lipoprotein receptor-related protein
9	9598.ENSPTRP00000002167	0.764	Uncharacterized protein
10	9598.ENSPTRP00000025968	0.761	Protein Wnt
11	9598.ENSPTRP00000035343	0.759	Scribbled planar cell polarity protein
12	9598.ENSPTRP00000014781	0.743	Dishevelled, dsh homolog 2
13	9598.ENSPTRP00000026979	0.742	Dishevelled, dsh homolog 3
14	9598.ENSPTRP00000050501	0.739	Protein tyrosine phosphatase, non-receptor type 6
15	9598.ENSPTRP00000038852	0.737	Guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1
16	9598.ENSPTRP00000017536	0.727	Uncharacterized protein
17	9598.ENSPTRP00000003525	0.725	Uncharacterized protein
18	9598.ENSPTRP00000026040	0.718	Prickle homolog 2
19	9598.ENSPTRP00000048270	0.710	Uncharacterized protein
20	9598.ENSPTRP00000052575	0.708	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.753	catalytic activity
GO:0140096	0.637	catalytic activity, acting on a protein
GO:0004672	0.496	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0007275	0.988	multicellular organism development
GO:0050896	0.986	response to stimulus
GO:0009653	0.986	anatomical structure morphogenesis
GO:0007154	0.985	cell communication
GO:0023052	0.982	signaling
GO:0007399	0.955	nervous system development
GO:0048518	0.954	positive regulation of biological process
GO:0051716	0.943	cellular response to stimulus
GO:0048513	0.936	animal organ development
GO:0007165	0.932	signal transduction
GO:0023051	0.930	regulation of signaling
GO:0010646	0.925	regulation of cell communication
GO:0048583	0.917	regulation of response to stimulus
GO:0048522	0.914	positive regulation of cellular process
GO:0035567	0.905	non-canonical Wnt signaling pathway
GO:0090175	0.895	regulation of establishment of planar polarity
GO:0035148	0.885	tube formation
GO:0002009	0.871	morphogenesis of an epithelium
GO:0030154	0.866	cell differentiation
GO:0071840	0.857	cellular component organization or biogenesis
GO:0060606	0.847	tube closure
GO:0072175	0.847	epithelial tube formation
GO:0016043	0.835	cellular component organization
GO:0043009	0.835	chordate embryonic development
GO:0048523	0.828	negative regulation of cellular process
GO:0009966	0.802	regulation of signal transduction
GO:0051179	0.794	localization
GO:0048598	0.793	embryonic morphogenesis
GO:0003401	0.790	axis elongation
GO:0030111	0.787	regulation of Wnt signaling pathway
GO:0001841	0.775	neural tube formation
GO:0014020	0.771	primary neural tube formation
GO:0042221	0.768	response to chemical
GO:0001843	0.763	neural tube closure
GO:0060828	0.719	regulation of canonical Wnt signaling pathway
GO:0007163	0.644	establishment or maintenance of cell polarity
GO:0051239	0.617	regulation of multicellular organismal process
GO:0051128	0.615	regulation of cellular component organization
GO:0022008	0.603	neurogenesis
GO:0001738	0.600	morphogenesis of a polarized epithelium
GO:0070887	0.589	cellular response to chemical stimulus
GO:0048699	0.585	generation of neurons
GO:0010033	0.576	response to organic substance
GO:0048870	0.548	cell motility
GO:0048468	0.539	cell development
GO:0008152	0.531	metabolic process
GO:0071310	0.518	cellular response to organic substance
GO:0071704	0.499	organic substance metabolic process
GO:0030010	0.466	establishment of cell polarity
GO:2000026	0.461	regulation of multicellular organismal development
GO:0044238	0.457	primary metabolic process
GO:0043170	0.427	macromolecule metabolic process
GO:0006807	0.426	nitrogen compound metabolic process
GO:0030182	0.417	neuron differentiation
GO:0019222	0.415	regulation of metabolic process
GO:0048584	0.401	positive regulation of response to stimulus
GO:0000902	0.395	cell morphogenesis
GO:0045595	0.389	regulation of cell differentiation
GO:0051130	0.388	positive regulation of cellular component organization
GO:0030030	0.381	cell projection organization
GO:0023056	0.375	positive regulation of signaling
GO:0060255	0.374	regulation of macromolecule metabolic process
GO:0065009	0.370	regulation of molecular function
GO:0120036	0.367	plasma membrane bounded cell projection organization
GO:0016477	0.366	cell migration
GO:0010975	0.347	regulation of neuron projection development
GO:0009967	0.347	positive regulation of signal transduction
GO:0031323	0.330	regulation of cellular metabolic process
GO:0065008	0.321	regulation of biological quality
GO:0048666	0.321	neuron development
GO:0061339	0.312	establishment or maintenance of monopolar cell polarity
GO:0009887	0.312	animal organ morphogenesis
GO:0072359	0.311	circulatory system development
GO:0009605	0.310	response to external stimulus
GO:0051171	0.308	regulation of nitrogen compound metabolic process
GO:0080090	0.307	regulation of primary metabolic process
GO:0048839	0.301	inner ear development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.999	cell junction
GO:0070161	0.994	anchoring junction
GO:0005911	0.949	cell-cell junction
GO:0005622	0.889	intracellular anatomical structure
GO:0043226	0.454	organelle
GO:0005737	0.445	cytoplasm
GO:0043227	0.404	membrane-bounded organelle
GO:0005925	0.378	focal adhesion
GO:0043229	0.348	intracellular organelle
GO:0043231	0.326	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.496	Phosphotransferases with an alcohol group as acceptor.

[back to server]