StarFunc result for job id Q13309

User Input

>input (424 residues)
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R069	0.803	0.803	7.044E-77	424	1.000	1.000	A0A024R069.pdb.gz
2	AFDB:A0A0A0MTL5	0.779	0.722	3.387E-73	458	1.000	0.926	A0A0A0MTL5.pdb.gz	A0A0A0MTL5_HUMAN S-phase kinase associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=2
3	AFDB:Q9Z0Z3	0.779	0.779	3.139E-68	424	0.863	0.863	Q9Z0Z3.pdb.gz	SKP2_MOUSE S-phase kinase-associated protein 2 OS=Mus musculus OX=10090 GN=Skp2 PE=1 SV=1
4	PDB:7b5mT	0.749	0.972	8.426E-51	325	0.767	1.000	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
5	AFDB:Q7YZ95	0.718	0.547	2.451E-33	559	0.307	0.233	Q7YZ95.pdb.gz	Q7YZ95_DROME S-phase kinase-associated protein 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Skp2 PE=1 SV=2
6	AFDB:D6RAG5	0.267	0.501	1.032E-24	217	0.512	1.000	D6RAG5.pdb.gz	D6RAG5_HUMAN S-phase kinase associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=1
7	AFDB:Q5BJ29	0.456	0.400	7.033E-17	491	0.198	0.171	Q5BJ29.pdb.gz	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
8	AFDB:A8DYA6	0.442	0.305	1.242E-16	651	0.212	0.138	A8DYA6.pdb.gz	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
9	AFDB:B1H1X1	0.463	0.302	2.395E-15	673	0.175	0.110	B1H1X1.pdb.gz	FXL17_XENLA F-box/LRR-repeat protein 17 OS=Xenopus laevis OX=8355 GN=fbxl17 PE=2 SV=1
10	AFDB:Q9UF56	0.328	0.228	3.775E-15	701	0.172	0.104	Q9UF56.pdb.gz	FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3
11	AFDB:Q9VF10	0.369	0.232	4.886E-14	772	0.217	0.119	Q9VF10.pdb.gz	Q9VF10_DROME F-box and leucine-rich repeat protein 7 OS=Drosophila melanogaster OX=7227 GN=Fbxl7 PE=1 SV=2
12	PDB:6o60C	0.417	0.447	5.916E-12	389	0.193	0.211	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
13	PDB:2p1nB	0.385	0.309	5.006E-10	571	0.165	0.123	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
14	PDB:3oglB	0.355	0.283	2.539E-8	568	0.118	0.088	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
15	PDB:7sa1B	0.391	0.282	6.678E-8	624	0.167	0.114	7sa1B.pdb.gz
16	PDB:4i6jB	0.392	0.414	4.893E-7	394	0.149	0.160	4i6jB.pdb.gz
17	PDB:7pmkL	0.308	0.283	8.643E-7	475	0.175	0.156	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7pzcA	0.432	0.207	1.616E-6	1010	0.146	0.061	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
19	PDB:5hywA	0.407	0.314	4.501E-6	580	0.156	0.114	5hywA.pdb.gz
20	PDB:4kxfP	0.317	0.184	5.339E-6	866	0.120	0.059	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MTL5	0.0	845	458	1.000	0.926	A0A0A0MTL5_HUMAN S-phase kinase associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=2
2	A0A8I6AMP0	0.0	726	439	0.856	0.827	A0A8I6AMP0_RAT S-phase kinase associated protein 2 OS=Rattus norvegicus OX=10116 GN=Skp2 PE=4 SV=1
3	Q13309	0.0	862	424	1.000	1.000	SKP2_HUMAN S-phase kinase-associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=2
4	Q9Z0Z3	0.0	756	424	0.863	0.863	SKP2_MOUSE S-phase kinase-associated protein 2 OS=Mus musculus OX=10090 GN=Skp2 PE=1 SV=1
5	D6RAG5	6.50e-84	258	217	0.292	0.571	D6RAG5_HUMAN S-phase kinase associated protein 2 OS=Homo sapiens OX=9606 GN=SKP2 PE=1 SV=1
6	Q9VN08	2.00e-63	214	499	0.281	0.238	Q9VN08_DROME RE15215p OS=Drosophila melanogaster OX=7227 GN=Skp2 PE=2 SV=1
7	Q7YZ95	7.02e-63	214	559	0.274	0.208	Q7YZ95_DROME S-phase kinase-associated protein 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Skp2 PE=1 SV=2
8	Q9CZV8	5.81e-15	78.6	436	0.184	0.179	FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus OX=10090 GN=Fbxl20 PE=1 SV=3
9	Q96IG2	1.46e-14	77.4	436	0.182	0.177	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
10	Q8BH16	3.00e-14	76.3	423	0.186	0.187	FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus OX=10090 GN=Fbxl2 PE=1 SV=1
11	Q9UKC9	8.33e-14	75.1	423	0.186	0.187	FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2 PE=1 SV=3
12	O49286	1.16e-13	74.3	360	0.175	0.206	SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana OX=3702 GN=SKP2B PE=1 SV=1
13	Q9LPL4	3.06e-13	72.8	360	0.160	0.189	SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana OX=3702 GN=SKP2A PE=1 SV=1
14	A8DYA6	5.50e-13	73.2	651	0.167	0.109	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
15	Q5BJ29	7.86e-13	72.4	491	0.170	0.147	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
16	Q9UJT9	9.66e-13	72.0	491	0.170	0.147	FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens OX=9606 GN=FBXL7 PE=1 SV=1
17	A1Z8M8	1.20e-12	71.6	464	0.167	0.153	A1Z8M8_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1
18	A0A0B4KEK4	1.26e-12	71.6	455	0.167	0.156	A0A0B4KEK4_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
19	A8DYA5	1.37e-12	71.2	426	0.167	0.167	A8DYA5_DROME LP16447p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=2 SV=1
20	A0A0B4KEU4	1.41e-12	71.6	497	0.167	0.143	A0A0B4KEU4_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=FBXL2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	1.2e-05	36.3	F-box domain
2	PF12937 F-box-like	4.5e-12	57.0	F-box-like
3	PF18511 F-box_5	1.6e+02	13.2	F-box
4	PF19729 FBXL18_LRR	1.8	18.6	F-box/LRR-repeat protein 18, LRR
5	PF00560 LRR_1	2.1e+02	13.9	Leucine Rich Repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
3	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
4	9606.ENSP00000274026	0.999	Cyclin-A2
5	9606.ENSP00000311083	0.999	Cyclin-dependent kinases regulatory subunit 1
6	9606.ENSP00000326804	0.999	Cullin-1
7	9606.ENSP00000479618	0.999	Myc proto-oncogene protein
8	9606.ENSP00000228872	0.998	Cyclin-dependent kinase inhibitor 1B
9	9606.ENSP00000301019	0.998	DNA replication factor Cdt1
10	9606.ENSP00000368880	0.998	Forkhead box protein O1
11	9606.ENSP00000215574	0.995	Ubiquitin-conjugating enzyme E2 R1
12	9606.ENSP00000263253	0.994	Histone acetyltransferase p300
13	9606.ENSP00000384849	0.994	Cyclin-dependent kinase inhibitor 1
14	9606.ENSP00000301764	0.981	DNA damage-binding protein 1
15	9606.ENSP00000359206	0.981	F-box/WD repeat-containing protein 1A
16	9606.ENSP00000360623	0.981	Origin recognition complex subunit 1
17	9606.ENSP00000267163	0.978	Retinoblastoma-associated protein
18	9606.ENSP00000269305	0.977	Cellular tumor antigen p53
19	9606.ENSP00000250495	0.973	NEDD8
20	9606.ENSP00000361540	0.973	Cell division cycle protein 20 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.560	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.997	regulation of biological process
GO:0044238	0.993	primary metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0050896	0.988	response to stimulus
GO:0044237	0.988	cellular metabolic process
GO:0070647	0.982	protein modification by small protein conjugation or removal
GO:0048518	0.978	positive regulation of biological process
GO:0006508	0.972	proteolysis
GO:0044260	0.970	cellular macromolecule metabolic process
GO:0016567	0.963	protein ubiquitination
GO:0019941	0.942	modification-dependent protein catabolic process
GO:0000278	0.936	mitotic cell cycle
GO:0048522	0.930	positive regulation of cellular process
GO:0006511	0.905	ubiquitin-dependent protein catabolic process
GO:0000209	0.882	protein polyubiquitination
GO:0019222	0.860	regulation of metabolic process
GO:0044770	0.860	cell cycle phase transition
GO:0060255	0.824	regulation of macromolecule metabolic process
GO:0051171	0.773	regulation of nitrogen compound metabolic process
GO:1903047	0.763	mitotic cell cycle process
GO:0080090	0.754	regulation of primary metabolic process
GO:0009605	0.743	response to external stimulus
GO:0051716	0.738	cellular response to stimulus
GO:0044772	0.736	mitotic cell cycle phase transition
GO:0042127	0.684	regulation of cell population proliferation
GO:0008284	0.641	positive regulation of cell population proliferation
GO:0044843	0.576	cell cycle G1/S phase transition
GO:0006950	0.569	response to stress
GO:0007154	0.551	cell communication
GO:0009893	0.505	positive regulation of metabolic process
GO:0031323	0.488	regulation of cellular metabolic process
GO:0051173	0.485	positive regulation of nitrogen compound metabolic process
GO:0010604	0.485	positive regulation of macromolecule metabolic process
GO:0048583	0.455	regulation of response to stimulus
GO:0051246	0.443	regulation of protein metabolic process
GO:0000082	0.361	G1/S transition of mitotic cell cycle
GO:0051726	0.350	regulation of cell cycle
GO:0023051	0.335	regulation of signaling
GO:0009966	0.334	regulation of signal transduction
GO:0051247	0.324	positive regulation of protein metabolic process
GO:0031399	0.322	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0032991	0.978	protein-containing complex
GO:0005730	0.957	nucleolus
GO:1902494	0.815	catalytic complex
GO:1990234	0.781	transferase complex
GO:0140535	0.680	intracellular protein-containing complex
GO:0000151	0.525	ubiquitin ligase complex
GO:0031461	0.510	cullin-RING ubiquitin ligase complex
GO:0019005	0.414	SCF ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]