StarFunc result for job id Q13315

User Input

>input (1400 residues)
MSLVLNDLLICCRQLEHDRATERKKEVEKFKRLIRDPETIKHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRIAKPNVSASTQASRQKKMQEISSLVKYFIKCANRRAPRLKCQEL
LNYIMDTVKDSSNGAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPSQ
DVHRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQCARQEKSSSGLNHILAALTIFL
KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYESTKWRSILYNLYDLLVNEISHIGSRGKYSSGFRNIAVKENLIELMADICHQVFNED
TRSLEISQSYTTTQRESSDYSVPCKRKKIELGWEVIKDHLQKSQNDFDLVPWLQIATQLI
SKYPASLPNCELSPLLMILSQLLPQQRHGERTPYVLRCLTEVALCQDKRSNLESSQKSDL
LKLWNKIWCITFRGISSEQIQAENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLTLALTTSIVPGTVKMGIEQNMCEVNRSFSLKESIMKWLLFYQLEGDLENSTEVPPILH
SNFPHLVLEKILVSLTMKNCKAAMNFFQSVPECEHHQKDKEELSFSEVEELFLQTTFDKM
DFLTIVRECGIEKHQSSIGFSVHQNLKESLDRCLLGLSEQLLNNYSSEITNSETLVRCSR
LLVGVLGCYCYMGVIAEEEAYKSELFQKAKSLMQCAGESITLFKNKTNEEFRIGSLRNMM
QLCTRCLSNCTKKSPNKIASGFFLRLLTSKLMNDIADICKSLASFIKKPFDRGEVESMED
DTNGNLMEVEDQSSMNLFNDYPDSSVSDANEPGESQSTIGAINPLAEEYLSKQDLLFLDM
LKFLCLCVTTAQTNTVSFRAADIRRKLLMLIDSSTLEPTKSLHLHMYLMLLKELPGEEYP
LPMEDVLELLKPLSNVCSLYRRDQDVCKTILNHVLHVVKNLGQSNMDSENTRDAQGQFLT
VIGAFWHLTKERKYIFSVRMALVNCLKTLLEADPYSKWAILNVMGKDFPVNEVFTQFLAD
NHHQVRMLAAESINRLFQDTKGDSSRLLKALPLKLQQTAFENAYLKAQEGMREMSHSAEN
PETLDEIYNRKSVLLTLIAVVLSCSPICEKQALFALCKSVKENGLEPHLVKKVLEKVSET
FGYRRLEDFMASHLDYLVLEWLNLQDTEYNLSSFPFILLNYTNIEDFYRSCYKVLIPHLV
IRSHFDEVKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTRDSGMAQQRETATKVYD
MLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPANSSASQSTDLCDFSGDLDPAPNPPH
FPSHVIKATFAYISNCHKTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7ni5A	0.874	0.442	0.000	2791	0.889	0.446	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
2	PDB:7sicA	0.851	0.432	0.000	2773	0.864	0.436	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
3	PDB:6k9kA	0.259	0.181	4.789E-31	2501	0.692	0.387	6k9kA.pdb.gz
4	PDB:6k9lA	0.292	0.192	8.470E-31	2552	0.704	0.386	6k9lA.pdb.gz
5	AFDB:B6V8N0	0.264	0.851	5.795E-23	416	0.157	0.529	B6V8N0.pdb.gz
6	AFDB:O00410	0.270	0.321	1.536E-8	1097	0.117	0.149	O00410.pdb.gz	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
7	PDB:6x9oA	0.211	0.147	1.883E-8	2425	0.127	0.073	6x9oA.pdb.gz
8	AFDB:G5ED41	0.186	0.198	2.622E-8	1274	0.120	0.132	G5ED41.pdb.gz	CAND1_CAEEL Cullin-associated NEDD8-dissociated protein 1 OS=Caenorhabditis elegans OX=6239 GN=cand-1 PE=1 SV=1
9	PDB:6xu2A	0.290	0.349	3.214E-8	1091	0.108	0.138	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	AFDB:F4HRS2	0.192	0.146	6.391E-8	2222	0.139	0.088	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
11	PDB:3w3uA	0.288	0.357	1.245E-7	1030	0.099	0.135	3w3uA.pdb.gz
12	AFDB:Q8L5Y6	0.209	0.231	2.224E-7	1219	0.099	0.114	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
13	AFDB:Q93VS8	0.302	0.356	2.565E-7	1116	0.109	0.137	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
14	AFDB:O60518	0.249	0.293	2.658E-7	1105	0.108	0.137	O60518.pdb.gz	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
15	PDB:6ez8A	0.203	0.146	3.034E-7	2353	0.125	0.074	6ez8A.pdb.gz
16	AFDB:Q9VN44	0.268	0.318	3.065E-7	1105	0.100	0.127	Q9VN44.pdb.gz	Q9VN44_DROME FI07923p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=1 SV=1
17	PDB:6kwyc	0.148	0.123	3.258E-7	1811	0.143	0.110	6kwyc.pdb.gz	Cryo-EM structures of the human PA200 and PA200-20S complex reveal regulation of proteasome gate opening and two PA200 apertures.
18	AFDB:O60100	0.278	0.332	3.796E-7	1067	0.102	0.134	O60100.pdb.gz	IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap123 PE=3 SV=1
19	AFDB:E9PVA8	0.132	0.088	4.224E-7	2671	0.121	0.064	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
20	PDB:7mq8SP	0.149	0.120	5.561E-7	1993	0.107	0.075	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ACL8	0.0	2339	3064	0.809	0.369	D4ACL8_RAT Serine-protein kinase ATM OS=Rattus norvegicus OX=10116 GN=Atm PE=1 SV=1
2	F1QJB6	0.0	1168	3091	0.470	0.213	F1QJB6_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=atm PE=1 SV=2
3	Q13315	0.0	2902	3056	1.000	0.458	ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens OX=9606 GN=ATM PE=1 SV=4
4	Q62388	0.0	2326	3066	0.812	0.371	ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus OX=10090 GN=Atm PE=1 SV=2
5	Q711Q0	1.6	35.8	1435	0.016	0.016	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
6	Q9M3G7	1.9	35.4	3856	0.036	0.013	ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana OX=3702 GN=ATM PE=1 SV=1
7	Q8RWH3	3.8	34.3	956	0.010	0.015	YAK1_ARATH Dual specificity protein kinase YAK1 homolog OS=Arabidopsis thaliana OX=3702 GN=YAK1 PE=1 SV=1
8	Q6SSJ6	7.4	33.5	639	0.012	0.027	MOBA_COMTE 3-hydroxybenzoate 4-monooxygenase OS=Comamonas testosteroni OX=285 GN=mobA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12862 ANAPC5	1.9e+02	13.5	Anaphase-promoting complex subunit 5
2	PF13251 DUF4042	2.7e+02	12.6	Domain of unknown function (DUF4042)
3	PF02985 HEAT	4e+02	12.7	HEAT repeat
4	PF11640 TAN	3.9e-20	84.0	Telomere-length maintenance and DNA damage repair
5	PF04869 Uso1_p115_head	63	14.2	Uso1 / p115 like vesicle tethering protein, head region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265433	0.999	Nibrin
2	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
3	9606.ENSP00000325863	0.999	Double-strand break repair protein MRE11
4	9606.ENSP00000340330	0.999	Histone acetyltransferase KAT5
5	9606.ENSP00000361423	0.999	Tyrosine-protein kinase ABL1
6	9606.ENSP00000365588	0.999	Mediator of DNA damage checkpoint protein 1
7	9606.ENSP00000371475	0.999	TP53-binding protein 1
8	9606.ENSP00000372023	0.999	Serine/threonine-protein kinase Chk2
9	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
10	9606.ENSP00000434024	0.999	Histone H2AX
11	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
12	9606.ENSP00000343741	0.998	Serine/threonine-protein kinase ATR
13	9606.ENSP00000352257	0.998	X-ray repair cross-complementing protein 6
14	9606.ENSP00000388648	0.998	Serine/threonine-protein kinase Chk1
15	9606.ENSP00000426191	0.998	Cell cycle checkpoint protein RAD17
16	9606.ENSP00000347232	0.997	Bloom syndrome protein
17	9606.ENSP00000375978	0.997	X-ray repair cross-complementing protein 5
18	9606.ENSP00000382628	0.997	DNA endonuclease RBBP8
19	9606.ENSP00000258149	0.996	E3 ubiquitin-protein ligase Mdm2
20	9606.ENSP00000323099	0.996	ATR-interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.982	protein serine/threonine kinase activity
GO:0016303	0.978	1-phosphatidylinositol-3-kinase activity
GO:0042802	0.974	identical protein binding
GO:0044877	0.970	protein-containing complex binding
GO:0004677	0.879	DNA-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043068	0.974	positive regulation of programmed cell death
GO:0051054	0.970	positive regulation of DNA metabolic process
GO:0043065	0.961	positive regulation of apoptotic process
GO:0048583	0.958	regulation of response to stimulus
GO:0009987	0.934	cellular process
GO:0009894	0.930	regulation of catabolic process
GO:0010564	0.908	regulation of cell cycle process
GO:0050896	0.885	response to stimulus
GO:0009628	0.884	response to abiotic stimulus
GO:0071704	0.867	organic substance metabolic process
GO:2001022	0.853	positive regulation of response to DNA damage stimulus
GO:2000278	0.850	regulation of DNA biosynthetic process
GO:0048519	0.848	negative regulation of biological process
GO:0044238	0.843	primary metabolic process
GO:0032210	0.842	regulation of telomere maintenance via telomerase
GO:0044237	0.836	cellular metabolic process
GO:0006259	0.826	DNA metabolic process
GO:0032206	0.824	positive regulation of telomere maintenance
GO:1902532	0.812	negative regulation of intracellular signal transduction
GO:0006310	0.791	DNA recombination
GO:0051716	0.753	cellular response to stimulus
GO:1901990	0.745	regulation of mitotic cell cycle phase transition
GO:0033554	0.737	cellular response to stress
GO:0042770	0.726	signal transduction in response to DNA damage
GO:0000077	0.721	DNA damage checkpoint signaling
GO:1902749	0.719	regulation of cell cycle G2/M phase transition
GO:0051983	0.707	regulation of chromosome segregation
GO:0022402	0.706	cell cycle process
GO:0000278	0.695	mitotic cell cycle
GO:0033045	0.686	regulation of sister chromatid segregation
GO:0010468	0.679	regulation of gene expression
GO:1903047	0.668	mitotic cell cycle process
GO:1904262	0.656	negative regulation of TORC1 signaling
GO:0032501	0.651	multicellular organismal process
GO:0032502	0.650	developmental process
GO:0008219	0.647	cell death
GO:0048856	0.644	anatomical structure development
GO:0006915	0.637	apoptotic process
GO:0006302	0.632	double-strand break repair
GO:1901564	0.629	organonitrogen compound metabolic process
GO:0043412	0.626	macromolecule modification
GO:0036211	0.620	protein modification process
GO:0006468	0.607	protein phosphorylation
GO:0010212	0.587	response to ionizing radiation
GO:0007275	0.587	multicellular organism development
GO:0007088	0.586	regulation of mitotic nuclear division
GO:0010389	0.585	regulation of G2/M transition of mitotic cell cycle
GO:1905818	0.584	regulation of chromosome separation
GO:0009892	0.560	negative regulation of metabolic process
GO:0031329	0.560	regulation of cellular catabolic process
GO:0002682	0.559	regulation of immune system process
GO:0010965	0.557	regulation of mitotic sister chromatid separation
GO:0030071	0.557	regulation of mitotic metaphase/anaphase transition
GO:0010605	0.550	negative regulation of macromolecule metabolic process
GO:0051172	0.542	negative regulation of nitrogen compound metabolic process
GO:0031324	0.541	negative regulation of cellular metabolic process
GO:0048731	0.518	system development
GO:0031328	0.502	positive regulation of cellular biosynthetic process
GO:0010557	0.496	positive regulation of macromolecule biosynthetic process
GO:0050865	0.487	regulation of cell activation
GO:0002694	0.484	regulation of leukocyte activation
GO:0045934	0.468	negative regulation of nucleobase-containing compound metabolic process
GO:0071840	0.447	cellular component organization or biogenesis
GO:0016043	0.424	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.979	cytoplasm
GO:0043232	0.841	intracellular non-membrane-bounded organelle
GO:0032991	0.649	protein-containing complex
GO:0005694	0.569	chromosome
GO:0005829	0.499	cytosol
GO:0005730	0.355	nucleolus
GO:0005782	0.341	peroxisomal matrix
GO:1902494	0.338	catalytic complex
GO:0000781	0.325	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:12709	0.978	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+)
EC:2.7.1.137	0.978	phosphatidylinositol 3-kinase.

[back to server]