StarFunc result for job id Q13319

User Input

>input (367 residues)
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKH
WTMNLDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35926	0.847	0.842	3.995E-44	369	0.956	0.951	O35926.pdb.gz	CD5R2_MOUSE Cyclin-dependent kinase 5 activator 2 OS=Mus musculus OX=10090 GN=Cdk5r2 PE=1 SV=2
2	AFDB:B3DH98	0.462	0.549	2.956E-21	306	0.460	0.552	B3DH98.pdb.gz	B3DH98_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=LOC568402 PE=2 SV=1
3	AFDB:P61809	0.500	0.592	1.925E-20	307	0.455	0.544	P61809.pdb.gz	CD5R1_MOUSE Cyclin-dependent kinase 5 activator 1 OS=Mus musculus OX=10090 GN=Cdk5r1 PE=1 SV=1
4	AFDB:Q6DGQ7	0.463	0.545	2.124E-20	310	0.441	0.523	Q6DGQ7.pdb.gz
5	AFDB:Q86T82	0.119	0.065	9.049E-2	979	0.191	0.072	Q86T82.pdb.gz	UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens OX=9606 GN=USP37 PE=1 SV=2
6	AFDB:P54733	0.141	0.087	3.261E-1	709	0.153	0.079	P54733.pdb.gz	CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster OX=7227 GN=CycE PE=1 SV=2
7	AFDB:Q08817	0.093	0.053	3.781E-1	791	0.120	0.056	Q08817.pdb.gz	SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOG2 PE=1 SV=1
8	AFDB:Q9FGR7	0.104	0.067	4.838E-1	723	0.109	0.055	Q9FGR7.pdb.gz	PP426_ARATH Pentatricopeptide repeat-containing protein At5g50280, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=EMB1006 PE=2 SV=1
9	AFDB:X1WEA3	0.103	0.047	5.082E-1	1034	0.172	0.061	X1WEA3.pdb.gz	X1WEA3_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=ulk2 PE=4 SV=1
10	PDB:1zp2A	0.187	0.281	5.429E-1	227	0.041	0.066	1zp2A.pdb.gz
11	AFDB:E3W994	0.124	0.051	5.892E-1	1273	0.172	0.049	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
12	PDB:2fd5A	0.117	0.186	6.294E-1	180	0.084	0.172	2fd5A.pdb.gz
13	PDB:7mq8LT	0.120	0.066	6.946E-1	869	0.128	0.054	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:3godA	0.127	0.141	7.298E-1	320	0.074	0.084	3godA.pdb.gz	Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
15	PDB:2pk9D	0.238	0.357	8.461E-1	219	0.057	0.096	2pk9D.pdb.gz
16	PDB:3vprA	0.114	0.173	8.889E-1	189	0.052	0.101	3vprA.pdb.gz
17	PDB:1itfA	0.113	0.179	9.338E-1	165	0.065	0.145	1itfA.pdb.gz
18	PDB:5jxdA	0.140	0.213	9.810E-1	186	0.038	0.075	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
19	PDB:3zc0B	0.105	0.147	1.083	191	0.046	0.089	3zc0B.pdb.gz	Structural Basis for Duplex RNA Recognition and Cleavage by Archaeoglobus Fulgidus C3Po.
20	PDB:2mgyA	0.105	0.173	1.319	169	0.071	0.154	2mgyA.pdb.gz	Structure of the mitochondrial translocator protein in complex with a diagnostic ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M491	0.0	588	368	0.954	0.951	F1M491_RAT Cyclin-dependent kinase 5 activator OS=Rattus norvegicus OX=10116 GN=Cdk5r2 PE=3 SV=2
2	O35926	0.0	586	369	0.954	0.949	CD5R2_MOUSE Cyclin-dependent kinase 5 activator 2 OS=Mus musculus OX=10090 GN=Cdk5r2 PE=1 SV=2
3	Q13319	0.0	729	367	1.000	1.000	CD5R2_HUMAN Cyclin-dependent kinase 5 activator 2 OS=Homo sapiens OX=9606 GN=CDK5R2 PE=1 SV=1
4	Q568S1	1.59e-112	332	308	0.526	0.627	Q568S1_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=zgc:110126 PE=2 SV=1
5	F1Q6W4	3.79e-100	300	304	0.455	0.549	F1Q6W4_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=cdk5r1 PE=3 SV=1
6	Q28199	8.34e-98	294	307	0.452	0.541	CD5R1_BOVIN Cyclin-dependent kinase 5 activator 1 OS=Bos taurus OX=9913 GN=CDK5R1 PE=1 SV=1
7	Q15078	3.70e-96	290	307	0.455	0.544	CD5R1_HUMAN Cyclin-dependent kinase 5 activator 1 OS=Homo sapiens OX=9606 GN=CDK5R1 PE=1 SV=1
8	Q8N619	1.97e-95	288	307	0.452	0.541	Q8N619_HUMAN Cyclin-dependent kinase 5 activator OS=Homo sapiens OX=9606 GN=CDK5R1 PE=1 SV=1
9	Q8TAM4	2.15e-95	288	307	0.452	0.541	Q8TAM4_HUMAN Cyclin-dependent kinase 5 activator OS=Homo sapiens OX=9606 GN=CDK5R1 PE=1 SV=1
10	B3DH98	1.72e-94	286	306	0.466	0.559	B3DH98_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=LOC568402 PE=2 SV=1
11	P61809	2.15e-90	275	307	0.441	0.528	CD5R1_MOUSE Cyclin-dependent kinase 5 activator 1 OS=Mus musculus OX=10090 GN=Cdk5r1 PE=1 SV=1
12	P61810	2.15e-90	275	307	0.441	0.528	CD5R1_RAT Cyclin-dependent kinase 5 activator 1 OS=Rattus norvegicus OX=10116 GN=Cdk5r1 PE=1 SV=1
13	Q9V3H5	4.18e-68	223	472	0.270	0.210	Q9V3H5_DROME Cyclin-dependent kinase 5 activator OS=Drosophila melanogaster OX=7227 GN=Cdk5alpha PE=2 SV=1
14	Q9Y0G0	8.14e-68	223	474	0.270	0.209	Q9Y0G0_DROME Cyclin-dependent kinase 5 activator OS=Drosophila melanogaster OX=7227 GN=Cdk5alpha PE=2 SV=1
15	Q22695	1.60e-51	177	356	0.223	0.230	CD5R1_CAEEL Cyclin-dependent kinase 5 activator 1 OS=Caenorhabditis elegans OX=6239 GN=cdka-1 PE=2 SV=2
16	A4UZU8	0.068	37.7	1365	0.060	0.016	A4UZU8_DROME Sterile20-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
17	Q59E61	0.069	37.7	1342	0.060	0.016	Q59E61_DROME FI24227p1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
18	Q7YZB2	0.069	37.7	1342	0.060	0.016	Q7YZB2_DROME Polo kinase kinase 1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=2 SV=1
19	Q8MLP1	0.081	37.7	1300	0.060	0.017	Q8MLP1_DROME Sterile20-like kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
20	B7YZQ1	0.089	37.4	1635	0.060	0.013	B7YZQ1_DROME Sterile20-like kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03261 CDK5_activator	8.2e-89	310.0	Cyclin-dependent kinase 5 activator protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304250

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419782	0.988	Cyclin-dependent-like kinase 5
2	9606.ENSP00000333982	0.940	Nuclear distribution protein nudE-like 1
3	9606.ENSP00000363270	0.733	RUN and FYVE domain containing 4
4	9606.ENSP00000398798	0.733	Zinc finger protein 142
5	9606.ENSP00000318486	0.723	Cyclin-dependent kinase 5 activator 1
6	9606.ENSP00000239938	0.678	Early growth response protein 1
7	9606.ENSP00000295709	0.674	Serine/threonine-protein kinase 36
8	9606.ENSP00000300131	0.650	NGFI-A-binding protein 2
9	9606.ENSP00000262545	0.647	Neuroendocrine convertase 2
10	9606.ENSP00000276570	0.642	DnaJ heat shock protein family member C5 beta
11	9606.ENSP00000287713	0.636	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
12	9606.ENSP00000295108	0.632	Neurogenic differentiation factor 1
13	9606.ENSP00000295728	0.629	Beta-crystallin A2
14	9606.ENSP00000455711	0.627	Transcriptional repressor scratch 1
15	9606.ENSP00000368244	0.620	Secretogranin-1
16	9606.ENSP00000233336	0.605	Tubulin--tyrosine ligase
17	9606.ENSP00000290583	0.578	CUGBP Elav-like family member 3
18	9606.ENSP00000387694	0.570	Solute carrier family 12 member 5
19	9606.ENSP00000308057	0.566	Beta-synuclein
20	9606.ENSP00000254976	0.563	Synaptosomal-associated protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061575	1.000	cyclin-dependent protein serine/threonine kinase activator activity
GO:0008092	0.936	cytoskeletal protein binding
GO:0003779	0.934	actin binding
GO:0003824	0.317	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0019222	0.798	regulation of metabolic process
GO:0051726	0.763	regulation of cell cycle
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0051171	0.726	regulation of nitrogen compound metabolic process
GO:0080090	0.724	regulation of primary metabolic process
GO:0031323	0.691	regulation of cellular metabolic process
GO:0032501	0.682	multicellular organismal process
GO:0032502	0.680	developmental process
GO:0048856	0.662	anatomical structure development
GO:0071900	0.654	regulation of protein serine/threonine kinase activity
GO:1904029	0.614	regulation of cyclin-dependent protein kinase activity
GO:0048518	0.470	positive regulation of biological process
GO:0007275	0.457	multicellular organism development
GO:0048731	0.387	system development
GO:0007399	0.328	nervous system development
GO:0048522	0.322	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.996	membrane
GO:0071944	0.930	cell periphery
GO:0005886	0.909	plasma membrane
GO:0043226	0.729	organelle
GO:0043229	0.723	intracellular organelle
GO:0043227	0.712	membrane-bounded organelle
GO:0042995	0.632	cell projection
GO:0120025	0.607	plasma membrane bounded cell projection
GO:0043005	0.596	neuron projection
GO:0030424	0.429	axon
GO:0030427	0.422	site of polarized growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]