StarFunc result for job id Q13322

User Input

>input (594 residues)
MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAV
RRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSK
VVEILADMTARDLCQLLVYKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASE
SKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVK
ELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPTDH
GLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHP
STLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIK
NFQILPCEDDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13322	1.000	1.000	0.000	594	1.000	1.000	Q13322.pdb.gz	GRB10_HUMAN Growth factor receptor-bound protein 10 OS=Homo sapiens OX=9606 GN=GRB10 PE=1 SV=2
2	AFDB:Q14449	0.633	0.694	1.360E-62	540	0.492	0.541	Q14449.pdb.gz	GRB14_HUMAN Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2
3	AFDB:Q03160	0.630	0.697	7.146E-62	535	0.476	0.529	Q03160.pdb.gz	GRB7_MOUSE Growth factor receptor-bound protein 7 OS=Mus musculus OX=10090 GN=Grb7 PE=1 SV=1
4	AFDB:O88900	0.669	0.735	3.362E-61	538	0.481	0.532	O88900.pdb.gz	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
5	AFDB:F2Z3U3	0.383	0.184	3.571E-25	1266	0.212	0.100	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
6	AFDB:Q9VWB7	0.392	0.205	6.207E-25	1162	0.204	0.104	Q9VWB7.pdb.gz	Q9VWB7_DROME LD06925p OS=Drosophila melanogaster OX=7227 GN=pico PE=2 SV=1
7	AFDB:P34400	0.383	0.296	5.180E-23	779	0.197	0.150	P34400.pdb.gz	MIG10_CAEEL Abnormal cell migration protein 10 OS=Caenorhabditis elegans OX=6239 GN=mig-10 PE=1 SV=3
8	AFDB:Q8WZ64	0.305	0.114	1.333E-8	1704	0.088	0.031	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
9	PDB:4k2rA	0.182	0.196	8.879E-7	551	0.052	0.056	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
10	PDB:4fl2A	0.163	0.174	1.171E-6	555	0.093	0.099	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
11	PDB:4rm8A	0.138	0.208	1.382E-6	368	0.081	0.130	4rm8A.pdb.gz
12	PDB:1k9aB	0.149	0.199	1.724E-6	441	0.047	0.063	1k9aB.pdb.gz
13	AFDB:A0A2R8Y5B3	0.165	0.124	2.848E-6	824	0.098	0.070	A0A2R8Y5B3.pdb.gz	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
14	PDB:1ka6A	0.149	0.732	4.414E-6	107	0.045	0.252	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
15	PDB:5xzrA	0.145	0.165	7.262E-6	519	0.052	0.060	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
16	PDB:1griA	0.138	0.364	1.759E-5	211	0.045	0.128	1griA.pdb.gz
17	PDB:4gwfA	0.141	0.168	1.859E-5	497	0.052	0.062	4gwfA.pdb.gz
18	PDB:2h8hA	0.157	0.205	2.451E-5	445	0.044	0.058	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	AFDB:Q9JMB3	0.161	0.097	2.905E-5	1105	0.099	0.053	Q9JMB3.pdb.gz
20	PDB:3ps5A	0.137	0.153	4.262E-5	529	0.049	0.055	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88900	0.0	571	538	0.487	0.537	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
2	P0CE43	0.0	891	599	0.749	0.743	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
3	Q03160	0.0	554	535	0.468	0.520	GRB7_MOUSE Growth factor receptor-bound protein 7 OS=Mus musculus OX=10090 GN=Grb7 PE=1 SV=1
4	Q13322	0.0	1236	594	1.000	1.000	GRB10_HUMAN Growth factor receptor-bound protein 10 OS=Homo sapiens OX=9606 GN=GRB10 PE=1 SV=2
5	Q14449	0.0	585	540	0.476	0.524	GRB14_HUMAN Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2
6	Q14451	0.0	556	532	0.471	0.526	GRB7_HUMAN Growth factor receptor-bound protein 7 OS=Homo sapiens OX=9606 GN=GRB7 PE=1 SV=2
7	Q5ICW4	0.0	587	540	0.483	0.531	GRB14_BOVIN Growth factor receptor-bound protein 14 OS=Bos taurus OX=9913 GN=GRB14 PE=1 SV=1
8	Q60760	0.0	820	621	0.657	0.628	GRB10_MOUSE Growth factor receptor-bound protein 10 OS=Mus musculus OX=10090 GN=Grb10 PE=1 SV=2
9	Q9JLM9	0.0	559	538	0.492	0.543	GRB14_MOUSE Growth factor receptor-bound protein 14 OS=Mus musculus OX=10090 GN=Grb14 PE=1 SV=1
10	Q9QZC5	0.0	550	535	0.468	0.520	GRB7_RAT Growth factor receptor-bound protein 7 OS=Rattus norvegicus OX=10116 GN=Grb7 PE=1 SV=1
11	Q8R5A3	2.79e-41	160	670	0.155	0.137	AB1IP_MOUSE Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Mus musculus OX=10090 GN=Apbb1ip PE=1 SV=2
12	Q7Z5R6	1.12e-39	156	666	0.152	0.135	AB1IP_HUMAN Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Homo sapiens OX=9606 GN=APBB1IP PE=1 SV=1
13	Q70E73	7.57e-38	152	1250	0.145	0.069	RAPH1_HUMAN Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3
14	C9K0J5	9.56e-38	152	1302	0.145	0.066	C9K0J5_HUMAN Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=1
15	F2Z3U3	3.10e-37	150	1266	0.145	0.068	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
16	G5E867	3.73e-37	149	679	0.146	0.128	G5E867_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
17	F2Z4B7	5.67e-37	148	645	0.146	0.135	F2Z4B7_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
18	M9MSQ5	6.48e-33	137	1113	0.138	0.074	M9MSQ5_DROME Pico, isoform C OS=Drosophila melanogaster OX=7227 GN=pico PE=4 SV=1
19	Q8IQW0	6.48e-33	137	1034	0.138	0.079	Q8IQW0_DROME Pico, isoform B OS=Drosophila melanogaster OX=7227 GN=pico PE=4 SV=1
20	Q9VWB7	6.91e-33	137	1162	0.138	0.071	Q9VWB7_DROME LD06925p OS=Drosophila melanogaster OX=7227 GN=pico PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11581 Argos	3.1e+02	12.8	Antagonist of EGFR signalling, Argos
2	PF08947 BPS	3.1e-25	99.1	BPS (Between PH and SH2)
3	PF15799 CCD48	1.4e+02	12.3	Coiled-coil domain-containing protein 48
4	PF00169 PH	2.6e-06	39.3	PH domain
5	PF15410 PH_9	1.1e+02	14.4	Pleckstrin homology domain
6	PF00788 RA	1.6e-07	43.2	Ras association (RalGDS/AF-6) domain
7	PF00017 SH2	1.8e-10	52.1	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424827	0.999	E3 ubiquitin-protein ligase NEDD4
2	9606.ENSP00000268035	0.997	Insulin-like growth factor 1 receptor
3	9606.ENSP00000302665	0.994	Insulin-like growth factor I
4	9606.ENSP00000303830	0.993	Insulin receptor
5	9606.ENSP00000387170	0.986	GRB10-interacting GYF protein 2
6	9606.ENSP00000304895	0.985	Insulin receptor substrate 1
7	9606.ENSP00000365016	0.973	Insulin receptor substrate 2
8	9606.ENSP00000451828	0.973	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000347942	0.971	Proto-oncogene tyrosine-protein kinase receptor Ret
10	9606.ENSP00000380432	0.967	Insulin
11	9606.ENSP00000275732	0.959	GRB10-interacting GYF protein 1
12	9606.ENSP00000261799	0.954	Platelet-derived growth factor receptor beta
13	9606.ENSP00000401303	0.940	SHC-transforming protein 1
14	9606.ENSP00000288135	0.934	Mast/stem cell growth factor receptor Kit
15	9606.ENSP00000233668	0.931	Docking protein 1
16	9606.ENSP00000336790	0.931	Cyclic AMP-dependent transcription factor ATF-4
17	9606.ENSP00000428056	0.925	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000275493	0.920	Epidermal growth factor receptor
19	9606.ENSP00000228280	0.909	Kit ligand
20	9606.ENSP00000347591	0.904	GDNF family receptor alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.960	identical protein binding
GO:0005102	0.728	signaling receptor binding
GO:0019899	0.481	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0048518	0.959	positive regulation of biological process
GO:0009966	0.957	regulation of signal transduction
GO:0048522	0.944	positive regulation of cellular process
GO:0050896	0.940	response to stimulus
GO:0023052	0.934	signaling
GO:0007154	0.934	cell communication
GO:0051716	0.934	cellular response to stimulus
GO:0048519	0.921	negative regulation of biological process
GO:0048523	0.906	negative regulation of cellular process
GO:0007165	0.874	signal transduction
GO:0048585	0.789	negative regulation of response to stimulus
GO:0023057	0.779	negative regulation of signaling
GO:0010648	0.779	negative regulation of cell communication
GO:0009968	0.743	negative regulation of signal transduction
GO:0019222	0.631	regulation of metabolic process
GO:0031323	0.508	regulation of cellular metabolic process
GO:0060255	0.499	regulation of macromolecule metabolic process
GO:0048584	0.480	positive regulation of response to stimulus
GO:0080090	0.470	regulation of primary metabolic process
GO:0007167	0.444	enzyme-linked receptor protein signaling pathway
GO:0009967	0.429	positive regulation of signal transduction
GO:0007169	0.397	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0008152	0.377	metabolic process
GO:0009889	0.348	regulation of biosynthetic process
GO:0071704	0.324	organic substance metabolic process
GO:0031326	0.324	regulation of cellular biosynthetic process
GO:0042221	0.317	response to chemical
GO:0010556	0.307	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.989	plasma membrane
GO:0032991	0.973	protein-containing complex
GO:0043226	0.839	organelle
GO:0043227	0.827	membrane-bounded organelle
GO:0043231	0.802	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]