StarFunc result for job id Q13323

User Input

>input (160 residues)
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR
LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR
FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13323	1.000	1.000	6.134E-25	160	1.000	1.000	Q13323.pdb.gz	BIK_HUMAN Bcl-2-interacting killer OS=Homo sapiens OX=9606 GN=BIK PE=1 SV=2
2	AFDB:Q925D2	0.248	0.250	1.636E-5	158	0.375	0.380	Q925D2.pdb.gz
3	AFDB:Q09771	0.242	0.191	1.932E-1	209	0.100	0.077	Q09771.pdb.gz	ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf31 PE=3 SV=1
4	AFDB:Q9SXL4	0.214	0.042	7.749E-1	1207	0.138	0.018	Q9SXL4.pdb.gz	AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=AHK1 PE=1 SV=2
5	AFDB:Q4V8G8	0.175	0.083	8.903E-1	490	0.144	0.047	Q4V8G8.pdb.gz	TEKT3_RAT Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE=1 SV=1
6	AFDB:O94656	0.223	0.242	1.023	143	0.119	0.133	O94656.pdb.gz	ATG16_SCHPO Autophagy protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg16 PE=1 SV=1
7	AFDB:P38325	0.239	0.278	1.175	134	0.075	0.090	P38325.pdb.gz	OM14_YEAST Mitochondrial outer membrane protein OM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OM14 PE=1 SV=1
8	AFDB:D6RGI6	0.205	0.253	1.260	128	0.125	0.156	D6RGI6.pdb.gz	D6RGI6_HUMAN GrpE like 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
9	AFDB:Q8MXV3	0.239	0.169	1.351	231	0.163	0.113	Q8MXV3.pdb.gz	Q8MXV3_CAEEL CEntrosomal Protein OS=Caenorhabditis elegans OX=6239 GN=ccep-135 PE=1 SV=1
10	AFDB:O43868	0.181	0.058	1.552	658	0.163	0.040	O43868.pdb.gz	S28A2_HUMAN Sodium/nucleoside cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC28A2 PE=2 SV=2
11	PDB:4ytpC	0.201	0.222	1.858	138	0.156	0.181	4ytpC.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
12	PDB:7ajuCK	0.155	0.121	3.472	222	0.100	0.072	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:2ndjA	0.145	0.202	3.989	103	0.075	0.117	2ndjA.pdb.gz
14	PDB:7rroD1	0.345	0.148	4.276	425	0.156	0.059	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:6wucK	0.202	0.155	4.913	235	0.094	0.064	6wucK.pdb.gz
16	PDB:7nac7	0.127	0.144	4.913	129	0.119	0.147	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
17	PDB:7mq9SI	0.224	0.061	6.486	844	0.106	0.020	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7lbmo	0.236	0.333	6.953	108	0.100	0.148	7lbmo.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:7ungA3	0.269	0.140	6.953	333	0.113	0.054	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:7ungD2	0.347	0.158	6.953	398	0.138	0.055	7ungD2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13323	1.41e-111	315	160	1.000	1.000	BIK_HUMAN Bcl-2-interacting killer OS=Homo sapiens OX=9606 GN=BIK PE=1 SV=2
2	A0A8I6GEH5	1.82e-30	110	191	0.412	0.346	A0A8I6GEH5_RAT BCL2-interacting killer OS=Rattus norvegicus OX=10116 GN=Bik PE=4 SV=1
3	O70337	1.18e-29	107	150	0.362	0.387	BIK_MOUSE Bcl-2-interacting killer OS=Mus musculus OX=10090 GN=Bik PE=1 SV=1
4	Q9P273	1.3	31.6	2699	0.125	0.007	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
5	Q9WTS6	1.3	31.6	2715	0.125	0.007	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
6	Q9W7R4	3.3	30.4	2694	0.125	0.007	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
7	A0A1D8PLP8	4.9	30.0	1787	0.100	0.009	A0A1D8PLP8_CANAL E3 ubiquitin-protein ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBR1 PE=3 SV=1
8	A0A8I5ZWB0	8.1	29.3	2238	0.069	0.005	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
9	A0A8J8XYU9	8.1	29.3	2215	0.069	0.005	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
10	Q8CJE3	8.1	29.3	2177	0.069	0.005	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
11	Q13402	8.3	29.3	2215	0.069	0.005	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
12	P97479	8.5	29.3	2215	0.069	0.005	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12201 bcl-2I13	1.1e-74	261.1	Bcl2-interacting killer, BH3-domain containing
2	PF06393 BID	4.4e+02	11.8	BH3 interacting domain (BID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216115

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.999	Bcl-2-like protein 1
2	9606.ENSP00000381185	0.990	Apoptosis regulator Bcl-2
3	9606.ENSP00000250405	0.972	Bcl-2-like protein 2
4	9606.ENSP00000267953	0.966	Bcl-2-related protein A1
5	9606.ENSP00000358022	0.965	Induced myeloid leukemia cell differentiation protein Mcl-1
6	9606.ENSP00000448165	0.950	Apoptotic protease-activating factor 1
7	9606.ENSP00000324173	0.921	78 kDa glucose-regulated protein
8	9606.ENSP00000376943	0.857	Bcl-2-like protein 11
9	9606.ENSP00000257572	0.822	Activator of apoptosis harakiri
10	9606.ENSP00000346697	0.812	Bcl-2-modifying factor
11	9606.ENSP00000326119	0.787	Phorbol-12-myristate-13-acetate-induced protein 1
12	9606.ENSP00000260442	0.756	Bcl-2-like protein 10
13	9606.ENSP00000359375	0.712	Fetal and adult testis-expressed transcript protein
14	9606.ENSP00000314132	0.692	Bcl-2-related ovarian killer protein
15	9606.ENSP00000384924	0.684	Protein Bop
16	9606.ENSP00000223136	0.683	Mitochondrial fission 1 protein
17	9606.ENSP00000452479	0.683	BCL2L2-PABPN1 readthrough
18	9606.ENSP00000300056	0.648	Peroxisomal membrane protein 11A
19	9606.ENSP00000358312	0.641	Peroxisomal membrane protein 11B
20	9606.ENSP00000307786	0.606	Cytochrome c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006915	0.990	apoptotic process
GO:0090199	0.987	regulation of release of cytochrome c from mitochondria
GO:0010941	0.986	regulation of cell death
GO:0044089	0.983	positive regulation of cellular component biogenesis
GO:0043067	0.977	regulation of programmed cell death
GO:0042981	0.974	regulation of apoptotic process
GO:0010822	0.972	positive regulation of mitochondrion organization
GO:0031334	0.966	positive regulation of protein-containing complex assembly
GO:0050896	0.465	response to stimulus
GO:0090200	0.367	positive regulation of release of cytochrome c from mitochondria
GO:0071840	0.338	cellular component organization or biogenesis
GO:0016043	0.310	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005737	0.953	cytoplasm
GO:0005739	0.863	mitochondrion
GO:0097136	0.624	Bcl-2 family protein complex
GO:0016020	0.586	membrane
GO:0031967	0.570	organelle envelope
GO:0005829	0.556	cytosol
GO:0005740	0.339	mitochondrial envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]