StarFunc result for job id Q13325

User Input

>input (482 residues)
MSEIRKDTLKAILLELECHFTWNLLKEDIDLFEVEDTIGQQLEFLTTKSRLALYNLLAYV
KHLKGQNKDALECLEQAEEIIQQEHSDKEEVRSLVTWGNYAWVYYHMDQLEEAQKYTGKI
GNVCKKLSSPSNYKLECPETDCEKGWALLKFGGKYYQKAKAAFEKALEVEPDNPEFNIGY
AITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAEAEGEKYIEE
ILDQISSQPYVLRYAAKFYRRKNSWNKALELLKKALEVTPTSSFLHHQMGLCYRAQMIQI
KKATHNRPKGKDKLKVDELISSAIFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDI
FRKALRLENITDDHKHQIHYHYGRFQEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSAL
KKLSTKRLCHNALDVQSLSALGFVYKLEGEKRQAAEYYEKAQKIDPENAEFLTALCELRL
SI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13325	1.000	1.000	6.252E-62	482	1.000	1.000	Q13325.pdb.gz	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
2	PDB:4horA	0.976	0.976	4.008E-56	482	1.000	1.000	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
3	AFDB:P09914	0.884	0.891	2.539E-37	478	0.546	0.550	P09914.pdb.gz	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
4	AFDB:Q5T764	0.883	0.898	6.826E-37	474	0.531	0.540	Q5T764.pdb.gz	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
5	PDB:5udkA	0.862	0.899	3.635E-35	461	0.546	0.570	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
6	AFDB:Q64282	0.870	0.904	6.158E-33	463	0.454	0.473	Q64282.pdb.gz	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
7	PDB:5w5iC	0.833	0.917	2.251E-32	436	0.519	0.573	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
8	AFDB:Q8IZ03	0.778	0.775	8.652E-31	484	0.442	0.440	Q8IZ03.pdb.gz	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
9	AFDB:Q64112	0.721	0.734	2.786E-27	472	0.376	0.383	Q64112.pdb.gz	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
10	AFDB:E7FBH4	0.858	0.858	4.960E-27	482	0.346	0.346	E7FBH4.pdb.gz	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
11	AFDB:O14879	0.739	0.728	2.592E-25	490	0.411	0.404	O14879.pdb.gz	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
12	PDB:4g1tB	0.598	0.661	4.178E-24	429	0.427	0.480	4g1tB.pdb.gz
13	AFDB:Q64345	0.616	0.728	1.557E-20	403	0.317	0.380	Q64345.pdb.gz	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
14	AFDB:A0A068FR04	0.662	0.726	1.097E-16	433	0.214	0.238	A0A068FR04.pdb.gz	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
15	PDB:7ntfA	0.431	0.250	6.781E-10	918	0.147	0.077	7ntfA.pdb.gz
16	PDB:7qe7J	0.436	0.415	1.759E-8	510	0.143	0.135	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:7qe7K	0.254	0.236	2.884E-8	531	0.145	0.132	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:7qdrB	0.341	0.160	4.179E-8	1212	0.174	0.069	7qdrB.pdb.gz
19	PDB:4bujB	0.395	0.169	4.538E-8	1367	0.139	0.049	4bujB.pdb.gz
20	PDB:7dkhI	0.320	0.200	4.538E-8	914	0.143	0.075	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09914	0.0	539	478	0.552	0.556	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
2	Q13325	0.0	997	482	1.000	1.000	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
3	Q5T764	0.0	523	474	0.535	0.544	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
4	Q64282	3.09e-146	428	463	0.461	0.479	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
5	P09913	9.29e-131	389	472	0.446	0.456	IFIT2_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=1
6	Q8IZ03	6.72e-130	387	484	0.446	0.444	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
7	O14879	1.96e-125	376	490	0.423	0.416	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
8	Q5T765	1.96e-125	376	490	0.423	0.416	Q5T765_HUMAN Interferon-induced protein with tetratricopeptide repeats 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=IFIT3 PE=2 SV=1
9	Q64112	1.61e-111	340	472	0.376	0.383	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
10	E7FBH4	1.42e-95	299	482	0.357	0.357	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
11	Q64345	9.58e-89	278	403	0.336	0.402	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
12	A0A068FR04	7.34e-34	134	433	0.222	0.247	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
13	Q9Y148	8.69e-06	50.8	1011	0.133	0.063	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
14	Q7KJA9	8.93e-06	50.8	1059	0.129	0.059	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
15	P81436	1.29e-05	50.4	1046	0.122	0.056	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
16	P56558	1.32e-05	50.4	1036	0.122	0.057	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
17	O15294	1.34e-05	50.4	1046	0.122	0.056	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
18	Q8CGY8	1.41e-05	50.1	1046	0.122	0.056	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
19	B5X0I6	1.70e-05	50.1	1091	0.143	0.063	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
20	Q5GA11	4.70e-05	48.5	1046	0.129	0.059	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.8	20.2	Anaphase-promoting complex, cyclosome, subunit 3
2	PF09920 DUF2150	2.1e+02	13.3	Uncharacterized protein conserved in archaea (DUF2150)
3	PF10373 EST1_DNA_bind	37	15.2	Est1 DNA/RNA binding domain
4	PF08311 Mad3_BUB1_I	2.9e+02	12.8	Mad3/BUB1 homology region 1
5	PF01535 PPR	7.4e+02	11.9	PPR repeat
6	PF08324 PUL	41	14.9	PUL domain
7	PF12931 Sec16_C	40	15.3	Sec23-binding domain of Sec16
8	PF00515 TPR_1	1.5e-16	70.6	Tetratricopeptide repeat
9	PF13374 TPR_10	0.0002	32.4	Tetratricopeptide repeat
10	PF13414 TPR_11	2.8e-09	47.8	TPR repeat
11	PF13424 TPR_12	2.7e-14	64.5	Tetratricopeptide repeat
12	PF13428 TPR_14	2.3e-13	60.7	Tetratricopeptide repeat
13	PF13429 TPR_15	6.8e-07	40.5	Tetratricopeptide repeat
14	PF13432 TPR_16	0.0024	29.7	Tetratricopeptide repeat
15	PF13431 TPR_17	9.1e-10	49.3	Tetratricopeptide repeat
16	PF14559 TPR_19	2.6e-12	58.3	Tetratricopeptide repeat
17	PF07719 TPR_2	1.1e-17	73.6	Tetratricopeptide repeat
18	PF13174 TPR_6	0.033	26.0	Tetratricopeptide repeat
19	PF13176 TPR_7	5.4e-08	43.4	Tetratricopeptide repeat
20	PF13181 TPR_8	7.2e-15	64.9	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360860

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371471	0.992	Radical S-adenosyl methionine domain-containing protein 2
2	9606.ENSP00000257570	0.991	2'-5'-oligoadenylate synthase-like protein
3	9606.ENSP00000381601	0.986	Interferon-induced GTP-binding protein Mx1
4	9606.ENSP00000228928	0.983	2'-5'-oligoadenylate synthase 3
5	9606.ENSP00000342278	0.983	2'-5'-oligoadenylate synthase 2
6	9606.ENSP00000360869	0.979	Interferon-induced protein with tetratricopeptide repeats 1
7	9606.ENSP00000360883	0.979	Interferon-induced protein with tetratricopeptide repeats 3
8	9606.ENSP00000333657	0.977	Interferon-induced GTP-binding protein Mx2
9	9606.ENSP00000368699	0.976	Ubiquitin-like protein ISG15
10	9606.ENSP00000388001	0.971	2'-5'-oligoadenylate synthase 1
11	9606.ENSP00000360891	0.970	Interferon-induced protein with tetratricopeptide repeats 2
12	9606.ENSP00000342513	0.969	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
13	9606.ENSP00000380697	0.968	Interferon regulatory factor 7
14	9606.ENSP00000395590	0.968	Interferon-induced 35 kDa protein
15	9606.ENSP00000354394	0.967	Signal transducer and activator of transcription 1-alpha/beta
16	9606.ENSP00000386187	0.959	Interferon-induced transmembrane protein 1
17	9606.ENSP00000380073	0.958	Interferon regulatory factor 9
18	9606.ENSP00000483430	0.958	Interferon alpha-inducible protein 27, mitochondrial
19	9606.ENSP00000245414	0.955	Interferon regulatory factor 1
20	9606.ENSP00000357459	0.952	Double-stranded RNA-specific adenosine deaminase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:0008187	0.945	poly-pyrimidine tract binding
GO:0000049	0.942	tRNA binding
GO:0008266	0.926	poly(U) RNA binding
GO:0000339	0.925	RNA cap binding
GO:0003677	0.910	DNA binding
GO:0003690	0.868	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0051707	0.995	response to other organism
GO:0050789	0.991	regulation of biological process
GO:0006950	0.986	response to stress
GO:0050794	0.984	regulation of cellular process
GO:0098542	0.980	defense response to other organism
GO:0048518	0.976	positive regulation of biological process
GO:0009615	0.970	response to virus
GO:0051607	0.950	defense response to virus
GO:0048519	0.947	negative regulation of biological process
GO:0045069	0.925	regulation of viral genome replication
GO:0048525	0.922	negative regulation of viral process
GO:0045071	0.883	negative regulation of viral genome replication
GO:0048522	0.856	positive regulation of cellular process
GO:0009987	0.842	cellular process
GO:0048583	0.512	regulation of response to stimulus
GO:0002376	0.485	immune system process
GO:0045087	0.429	innate immune response
GO:0051716	0.422	cellular response to stimulus
GO:0048584	0.415	positive regulation of response to stimulus
GO:0042221	0.347	response to chemical
GO:0010033	0.339	response to organic substance
GO:0009966	0.318	regulation of signal transduction
GO:0019222	0.304	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.968	intracellular organelle
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0012505	0.651	endomembrane system
GO:0070013	0.544	intracellular organelle lumen
GO:0016020	0.402	membrane
GO:0005634	0.399	nucleus
GO:0043232	0.372	intracellular non-membrane-bounded organelle
GO:0032991	0.320	protein-containing complex
GO:0005886	0.308	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]