StarFunc result for job id Q13330

User Input

>input (715 residues)
MAANMYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALAD
KHATLSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPAT
HIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDL
LKEGEEDGRDQSRLETQVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHM
SAAAASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEAL
EKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYN
KPNPNQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASC
WTYWKKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTR
IARRLCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRY
LETHPRPPKPDPVKSVSSVLSSLTPAKVAPVINNGSPTILGKRSYEQHNGVDGNMKKRLL
MPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYM
ATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRPPPPAPVNDEPIVIED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13330	1.000	1.000	0.000	715	1.000	1.000	Q13330.pdb.gz	MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2
2	AFDB:E7EY65	0.570	0.574	1.769E-83	709	0.635	0.640	E7EY65.pdb.gz	E7EY65_DANRE Metastasis-associated 1 family, member 3 OS=Danio rerio OX=7955 GN=fj99h01 PE=1 SV=1
3	PDB:7aoaD	0.206	0.413	3.098E-45	343	0.464	0.968	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
4	AFDB:M9PHT1	0.174	0.069	7.281E-8	2007	0.164	0.058	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
5	AFDB:Q6PGA0	0.167	0.253	1.436E-7	451	0.110	0.175	Q6PGA0.pdb.gz	RCOR3_MOUSE REST corepressor 3 OS=Mus musculus OX=10090 GN=Rcor3 PE=1 SV=2
6	PDB:5z8lA	0.131	0.435	1.017E-5	204	0.041	0.142	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
7	PDB:7vdvW	0.068	0.183	4.431E-2	248	0.036	0.105	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
8	PDB:6lthO	0.068	0.144	6.587E-2	325	0.034	0.074	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
9	AFDB:F1Q9S0	0.071	0.100	6.879E-2	469	0.092	0.141	F1Q9S0.pdb.gz	F1Q9S0_DANRE Paired box 3b OS=Danio rerio OX=7955 GN=pax3b PE=3 SV=2
10	AFDB:Q54DS6	0.094	0.039	7.280E-2	2221	0.126	0.041	Q54DS6.pdb.gz	Q54DS6_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=docA PE=3 SV=1
11	AFDB:P52168	0.049	0.065	9.130E-2	540	0.060	0.080	P52168.pdb.gz	PNR_DROME GATA-binding factor A OS=Drosophila melanogaster OX=7227 GN=pnr PE=1 SV=1
12	AFDB:Q54GH3	0.061	0.064	1.520E-1	663	0.074	0.080	Q54GH3.pdb.gz	TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum OX=44689 GN=tom1 PE=1 SV=1
13	AFDB:Q9M9A3	0.060	0.122	1.608E-1	314	0.062	0.140	Q9M9A3.pdb.gz	Q9M9A3_ARATH At1g49010 OS=Arabidopsis thaliana OX=3702 GN=MYBS1 PE=1 SV=1
14	AFDB:Q8CIA7	0.047	0.041	1.702E-1	853	0.127	0.107	Q8CIA7.pdb.gz	Q8CIA7_MOUSE Plekha5 protein OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
15	PDB:5l3cB	0.077	0.357	2.422E-1	134	0.042	0.224	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
16	PDB:7vdvX	0.062	0.168	3.038E-1	252	0.027	0.075	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
17	PDB:4czzB	0.075	0.358	3.600E-1	133	0.042	0.226	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
18	PDB:2cjjA	0.066	0.643	7.103E-1	63	0.018	0.206	2cjjA.pdb.gz
19	PDB:6k15H	0.058	0.104	7.103E-1	393	0.018	0.033	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:7dcoL	0.064	0.103	8.418E-1	435	0.035	0.057	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GV01	0.0	812	668	0.590	0.632	B2GV01_RAT Metastasis-associated gene family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
2	E7EQY4	0.0	787	514	0.543	0.755	E7EQY4_HUMAN Metastasis associated 1 family member 3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=1
3	E7ESY4	0.0	1457	703	0.983	1.000	E7ESY4_HUMAN Metastasis associated 1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
4	E7EY65	0.0	851	709	0.648	0.653	E7EY65_DANRE Metastasis-associated 1 family, member 3 OS=Danio rerio OX=7955 GN=fj99h01 PE=1 SV=1
5	F1QLG2	0.0	769	663	0.580	0.626	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
6	F6RRE2	0.0	717	537	0.512	0.682	F6RRE2_HUMAN Metastasis associated 1 family member 3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=1
7	F7F888	0.0	808	670	0.590	0.630	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
8	H0Y4T7	0.0	1051	511	0.709	0.992	H0Y4T7_HUMAN Metastasis associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
9	O94776	0.0	813	668	0.592	0.633	MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1
10	Q13330	0.0	1488	715	1.000	1.000	MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2
11	Q62599	0.0	1424	703	0.955	0.972	MTA1_RAT Metastasis-associated protein MTA1 OS=Rattus norvegicus OX=10116 GN=Mta1 PE=1 SV=1
12	Q7SXR7	0.0	740	631	0.548	0.621	Q7SXR7_DANRE Metastasis associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fi29g02 PE=1 SV=1
13	Q7ZUE1	0.0	771	517	0.541	0.749	Q7ZUE1_DANRE Metastasis associated family, member 3 OS=Danio rerio OX=7955 GN=wu:fj99h01 PE=1 SV=1
14	Q8K4B0	0.0	1454	715	0.971	0.971	MTA1_MOUSE Metastasis-associated protein MTA1 OS=Mus musculus OX=10090 GN=Mta1 PE=1 SV=1
15	Q924K8	0.0	825	591	0.594	0.719	MTA3_MOUSE Metastasis-associated protein MTA3 OS=Mus musculus OX=10090 GN=Mta3 PE=1 SV=1
16	Q9BTC8	0.0	836	594	0.587	0.707	MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2
17	Q9R190	0.0	810	668	0.589	0.630	MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus OX=10090 GN=Mta2 PE=1 SV=1
18	Q6AWS2	3.27e-178	532	857	0.379	0.316	Q6AWS2_DROME SD15071p OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
19	F8W9Y9	9.59e-177	506	255	0.351	0.984	F8W9Y9_HUMAN Metastasis associated 1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
20	Q9BRL8	4.65e-176	504	255	0.350	0.980	Q9BRL8_HUMAN MTA1 protein OS=Homo sapiens OX=9606 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01426 BAH	1.1e-32	123.8	BAH domain
2	PF01448 ELM2	3.3e-10	51.9	ELM2 domain
3	PF00320 GATA	2.9e-06	38.1	GATA zinc finger
4	PF17226 MTA_R1	5.3e-34	127.6	MTA R1 domain
5	PF00249 Myb_DNA-binding	0.0069	27.9	Myb-like DNA-binding domain
6	PF15963 Myb_DNA-bind_7	7.8	17.7	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362592	0.999	Histone-binding protein RBBP4
2	9606.ENSP00000362649	0.999	Histone deacetylase 1
3	9606.ENSP00000430432	0.999	Histone deacetylase 2
4	9606.ENSP00000349508	0.998	Chromodomain-helicase-DNA-binding protein 4
5	9606.ENSP00000369424	0.997	Histone-binding protein RBBP7
6	9606.ENSP00000405330	0.996	Estrogen receptor
7	9606.ENSP00000353463	0.993	Transcriptional repressor p66-alpha
8	9606.ENSP00000369716	0.993	Chromodomain-helicase-DNA-binding protein 3
9	9606.ENSP00000412302	0.993	Methyl-CpG-binding domain protein 3
10	9606.ENSP00000256429	0.990	Methyl-CpG-binding domain protein 2
11	9606.ENSP00000357644	0.979	Transcriptional repressor p66-beta
12	9606.ENSP00000262450	0.976	Chromodomain-helicase-DNA-binding protein 5
13	9606.ENSP00000278823	0.970	Metastasis-associated protein MTA2
14	9606.ENSP00000314080	0.968	Hypermethylated in cancer 1 protein
15	9606.ENSP00000269305	0.965	Cellular tumor antigen p53
16	9606.ENSP00000383042	0.955	Lysine-specific histone demethylase 1A
17	9606.ENSP00000383973	0.939	Metastasis-associated protein MTA3
18	9606.ENSP00000434024	0.937	Histone H2AX
19	9606.ENSP00000296417	0.935	Histone H2A.Z
20	9606.ENSP00000359575	0.933	LIM domain transcription factor LMO4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003712	0.998	transcription coregulator activity
GO:0003676	0.997	nucleic acid binding
GO:0008134	0.995	transcription factor binding
GO:0140297	0.994	DNA-binding transcription factor binding
GO:0043565	0.985	sequence-specific DNA binding
GO:0000976	0.978	transcription cis-regulatory region binding
GO:0061629	0.977	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000978	0.916	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003713	0.904	transcription coactivator activity
GO:0003714	0.898	transcription corepressor activity
GO:0019899	0.767	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.986	regulation of biological process
GO:0019222	0.967	regulation of metabolic process
GO:0050794	0.939	regulation of cellular process
GO:0010468	0.929	regulation of gene expression
GO:0071704	0.924	organic substance metabolic process
GO:0044238	0.900	primary metabolic process
GO:0016043	0.891	cellular component organization
GO:0006338	0.875	chromatin remodeling
GO:0043170	0.871	macromolecule metabolic process
GO:0044237	0.867	cellular metabolic process
GO:0050896	0.863	response to stimulus
GO:0048518	0.833	positive regulation of biological process
GO:0031323	0.828	regulation of cellular metabolic process
GO:0048519	0.825	negative regulation of biological process
GO:1901564	0.819	organonitrogen compound metabolic process
GO:0048523	0.819	negative regulation of cellular process
GO:0019219	0.816	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.812	regulation of cellular biosynthetic process
GO:0010556	0.811	regulation of macromolecule biosynthetic process
GO:0098732	0.796	macromolecule deacylation
GO:0032501	0.783	multicellular organismal process
GO:0016570	0.774	histone modification
GO:2001141	0.774	regulation of RNA biosynthetic process
GO:0006974	0.771	cellular response to DNA damage stimulus
GO:0006476	0.769	protein deacetylation
GO:0016575	0.756	histone deacetylation
GO:0044260	0.734	cellular macromolecule metabolic process
GO:0006355	0.704	regulation of DNA-templated transcription
GO:0009892	0.690	negative regulation of metabolic process
GO:0010604	0.687	positive regulation of macromolecule metabolic process
GO:0051173	0.664	positive regulation of nitrogen compound metabolic process
GO:0010605	0.613	negative regulation of macromolecule metabolic process
GO:1901360	0.608	organic cyclic compound metabolic process
GO:0006725	0.604	cellular aromatic compound metabolic process
GO:0034641	0.600	cellular nitrogen compound metabolic process
GO:0090304	0.585	nucleic acid metabolic process
GO:0051172	0.561	negative regulation of nitrogen compound metabolic process
GO:0048522	0.534	positive regulation of cellular process
GO:0010212	0.518	response to ionizing radiation
GO:0031324	0.501	negative regulation of cellular metabolic process
GO:0006302	0.490	double-strand break repair
GO:0051246	0.364	regulation of protein metabolic process
GO:0045934	0.352	negative regulation of nucleobase-containing compound metabolic process
GO:0031325	0.346	positive regulation of cellular metabolic process
GO:0051253	0.339	negative regulation of RNA metabolic process
GO:0006357	0.338	regulation of transcription by RNA polymerase II
GO:0045892	0.333	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.993	cytosol
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0032991	0.987	protein-containing complex
GO:0000785	0.941	chromatin
GO:0140513	0.938	nuclear protein-containing complex
GO:1902494	0.935	catalytic complex
GO:0005667	0.855	transcription regulator complex
GO:0090545	0.756	CHD-type complex
GO:0016581	0.737	NuRD complex
GO:0005856	0.356	cytoskeleton
GO:0005635	0.350	nuclear envelope
GO:0005874	0.350	microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]