StarFunc result for job id Q13332

User Input

>input (1948 residues)
MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDP
KPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHA
KLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSAS
NGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREV
RRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLEL
TDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPV
SYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTR
TGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV
DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETS
ITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQ
GLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP
LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVP
SAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLA
DAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSV
QQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGAT
YVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNG
AIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGP
FSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEFPDNYNSPTPYKIQYNGLTLDVDGR
TTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLNGKPSVAPKPDADGFIMV
YLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHSR
QLEVPRPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAAS
PFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPR
TKCLLNNADLAPHHPKDPVEMRRINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAE
HTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG
IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK
CDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGV
PEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGH
VTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGM
ELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASF
IDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSA
RYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFI
GQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRP
AMVQTEDEYQFCYQAALEYLGSFDHYAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0H2UKT5	0.303	0.308	0.000	1914	0.635	0.646	A0A0H2UKT5.pdb.gz
2	AFDB:A0A286Y939	0.298	0.737	0.000	780	0.315	0.787	A0A286Y939.pdb.gz
3	AFDB:A4IFW2	0.302	0.308	0.000	1909	0.641	0.654	A4IFW2.pdb.gz	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
4	AFDB:B0V2N1	0.332	0.337	0.000	1907	0.919	0.939	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
5	AFDB:F1NWE3	0.319	0.407	0.000	1516	0.703	0.903	F1NWE3.pdb.gz	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
6	AFDB:F1QJW2	0.396	0.401	0.000	1918	0.714	0.725	F1QJW2.pdb.gz
7	AFDB:P10586	0.299	0.305	0.000	1907	0.662	0.676	P10586.pdb.gz	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
8	AFDB:P16621	0.306	0.294	0.000	2029	0.488	0.468	P16621.pdb.gz	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
9	AFDB:P23468	0.322	0.328	0.000	1912	0.710	0.724	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
10	AFDB:Q13332	1.000	1.000	0.000	1948	1.000	1.000	Q13332.pdb.gz	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
11	PDB:4gwfA	0.142	0.544	1.774E-24	497	0.059	0.229	4gwfA.pdb.gz
12	PDB:3ps5A	0.145	0.521	4.020E-24	529	0.054	0.198	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:5xzrA	0.143	0.526	1.473E-23	519	0.059	0.220	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:5oj2B	0.070	0.151	7.989E-22	692	0.054	0.153	5oj2B.pdb.gz
15	PDB:6krwA	0.135	0.809	1.080E-19	306	0.045	0.288	6krwA.pdb.gz
16	PDB:1e07A	0.098	0.203	4.801E-19	642	0.049	0.148	1e07A.pdb.gz
17	PDB:5a42A	0.076	0.086	1.318E-18	1597	0.061	0.075	5a42A.pdb.gz
18	PDB:7q5zA	0.078	0.094	5.620E-17	1344	0.052	0.076	7q5zA.pdb.gz
19	PDB:7q1yA	0.070	0.090	5.658E-16	1374	0.049	0.069	7q1yA.pdb.gz
20	PDB:6h03A	0.092	0.127	6.536E-16	1223	0.050	0.079	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQN2	1542	1506	0.398	0.515	A0A8I5ZQN2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
2	A0A8I6A1V1	2888	1912	0.713	0.726	A0A8I6A1V1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
3	A0A8I6A6R5	2871	1920	0.713	0.723	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
4	A0A8I6A789	1545	1505	0.401	0.519	A0A8I6A789_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
5	A0A8I6AEM0	2837	1897	0.706	0.725	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
6	A2A8L5	2536	1898	0.669	0.687	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
7	A4IFW2	2496	1909	0.642	0.655	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
8	B0V2N1	3634	1907	0.922	0.942	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
9	B2GV87	566	699	0.146	0.406	PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus OX=10116 GN=Ptpre PE=2 SV=1
10	F1NWE3	1118	1516	0.289	0.371	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
11	F1QE38	594	831	0.147	0.345	F1QE38_DANRE Receptor-type tyrosine-protein phosphatase alpha OS=Danio rerio OX=7955 GN=RPTP[a] PE=1 SV=1
12	G5EDC5	840	2009	0.293	0.284	G5EDC5_CAEEL protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptp-3 PE=1 SV=2
13	G5EE54	840	1985	0.293	0.287	G5EE54_CAEEL protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptp-3 PE=1 SV=1
14	H9CWQ2	2441	1894	0.633	0.651	H9CWQ2_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=LAR PE=2 SV=1
15	M0RB22	2872	1899	0.713	0.731	M0RB22_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=3
16	P10586	2539	1907	0.668	0.682	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
17	P16621	1230	2029	0.408	0.392	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
18	P18052	588	829	0.157	0.369	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
19	P18433	608	802	0.161	0.392	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
20	P23468	2887	1912	0.712	0.725	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	0.067	24.6	CD80-like C2-set immunoglobulin domain
2	PF00782 DSPc	4.7e-05	34.7	Dual specificity phosphatase, catalytic domain
3	PF19167 DUF5849	2.2e+02	13.0	Family of unknown function (DUF5849)
4	PF00041 fn3	1.7e-106	360.1	Fibronectin type III domain
5	PF07679 I-set	1.5e-37	138.9	Immunoglobulin I-set domain
6	PF00047 ig	1.3e-12	59.1	Immunoglobulin domain
7	PF13895 Ig_2	2.1e-17	74.5	Immunoglobulin domain
8	PF13927 Ig_3	2.5e-34	129.0	Immunoglobulin domain
9	PF17736 Ig_C17orf99	33	15.9	C17orf99 Ig domain
10	PF09294 Interfer-bind	9.4e-05	34.0	Interferon-alpha/beta receptor, fibronectin type III
11	PF10179 NDNF	2.9	19.4	Neuron-derived neurotrophic factor, first Fn(III) domain
12	PF14566 PTPlike_phytase	0.08	24.5	Inositol hexakisphosphate
13	PF16656 Pur_ac_phosph_N	5.7e-16	70.3	Purple acid Phosphatase, N-terminal domain
14	PF07686 V-set	0.00078	31.0	Immunoglobulin V-set domain
15	PF00102 Y_phosphatase	1.9e-162	549.8	Protein-tyrosine phosphatase
16	PF13350 Y_phosphatase3	0.00087	31.0	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354207	0.998	NT-3 growth factor receptor
2	9606.ENSP00000253925	0.996	Liprin-alpha-1
3	9606.ENSP00000471502	0.996	Leucine-rich repeat-containing protein 4B
4	9606.ENSP00000359864	0.982	Glypican-4
5	9606.ENSP00000368678	0.973	Agrin
6	9606.ENSP00000298119	0.961	Leucine-rich repeat and fibronectin type-III domain-containing protein 5
7	9606.ENSP00000335614	0.928	Liprin-alpha-3
8	9606.ENSP00000450337	0.926	Liprin-alpha-2
9	9606.ENSP00000397297	0.925	Neurotrophin-3
10	9606.ENSP00000252575	0.922	Neurocan core protein
11	9606.ENSP00000366288	0.919	SLIT and NTRK-like protein 1
12	9606.ENSP00000368278	0.883	Interleukin-1 receptor accessory protein-like 1
13	9606.ENSP00000299492	0.879	Liprin-beta-2
14	9606.ENSP00000314724	0.879	Liprin-beta-1
15	9606.ENSP00000386357	0.865	Leucine-rich repeat transmembrane neuronal protein 4
16	9606.ENSP00000272198	0.864	Liprin-alpha-4
17	9606.ENSP00000416293	0.828	Solute carrier family 2, facilitated glucose transporter member 1
18	9606.ENSP00000027335	0.825	Cadherin-17
19	9606.ENSP00000369756	0.825	Receptor-type tyrosine-protein phosphatase alpha
20	9606.ENSP00000292377	0.816	Glypican-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004721	1.000	phosphoprotein phosphatase activity
GO:0038023	0.953	signaling receptor activity
GO:0004888	0.929	transmembrane signaling receptor activity
GO:0004725	0.920	protein tyrosine phosphatase activity
GO:0097367	0.655	carbohydrate derivative binding
GO:0008201	0.574	heparin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0051128	0.953	regulation of cellular component organization
GO:0071840	0.875	cellular component organization or biogenesis
GO:0034330	0.858	cell junction organization
GO:0007155	0.825	cell adhesion
GO:0048856	0.761	anatomical structure development
GO:0032501	0.760	multicellular organismal process
GO:0007275	0.751	multicellular organism development
GO:0050808	0.743	synapse organization
GO:0050896	0.692	response to stimulus
GO:0048731	0.682	system development
GO:0044238	0.631	primary metabolic process
GO:0044237	0.630	cellular metabolic process
GO:0071704	0.629	organic substance metabolic process
GO:0006807	0.587	nitrogen compound metabolic process
GO:0007399	0.562	nervous system development
GO:0048519	0.542	negative regulation of biological process
GO:1901564	0.531	organonitrogen compound metabolic process
GO:0043170	0.502	macromolecule metabolic process
GO:0048523	0.460	negative regulation of cellular process
GO:0050807	0.456	regulation of synapse organization
GO:0023052	0.427	signaling
GO:0007154	0.425	cell communication
GO:0044087	0.425	regulation of cellular component biogenesis
GO:0051716	0.415	cellular response to stimulus
GO:0019538	0.410	protein metabolic process
GO:0048583	0.379	regulation of response to stimulus
GO:0006796	0.363	phosphate-containing compound metabolic process
GO:0048518	0.359	positive regulation of biological process
GO:0036211	0.354	protein modification process
GO:0099175	0.322	regulation of postsynapse organization
GO:0048522	0.310	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.997	membrane-bounded organelle
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005737	0.981	cytoplasm
GO:0031982	0.974	vesicle
GO:0012505	0.943	endomembrane system
GO:0005576	0.941	extracellular region
GO:0005829	0.918	cytosol
GO:0030054	0.840	cell junction
GO:0005615	0.812	extracellular space
GO:1903561	0.772	extracellular vesicle
GO:0070062	0.759	extracellular exosome
GO:0045202	0.631	synapse
GO:0098978	0.454	glutamatergic synapse
GO:0098590	0.417	plasma membrane region
GO:0097060	0.385	synaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.920	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.920	protein-tyrosine-phosphatase.

[back to server]