StarFunc result for job id Q13347

User Input

>input (325 residues)
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA
DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQC
FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEV
LVNVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPN
YDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
SSGGEDGYVRIHYFDPQYFEFEFEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0BNA7	0.998	0.998	1.817E-67	325	0.994	0.994	B0BNA7.pdb.gz	EIF3I_RAT Eukaryotic translation initiation factor 3 subunit I OS=Rattus norvegicus OX=10116 GN=Eif3i PE=2 SV=1
2	AFDB:Q7ZV55	0.994	0.994	3.830E-61	325	0.837	0.837	Q7ZV55.pdb.gz	EIF3I_DANRE Eukaryotic translation initiation factor 3 subunit I OS=Danio rerio OX=7955 GN=eif3i PE=2 SV=1
3	PDB:6zonI	0.867	0.921	1.156E-46	305	0.935	0.997	6zonI.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
4	AFDB:P79083	0.970	0.961	6.205E-43	328	0.492	0.488	P79083.pdb.gz	EIF3I_SCHPO Eukaryotic translation initiation factor 3 subunit I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sum1 PE=1 SV=1
5	AFDB:P40217	0.956	0.896	2.107E-42	347	0.462	0.432	P40217.pdb.gz	EIF3I_YEAST Eukaryotic translation initiation factor 3 subunit I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF34 PE=1 SV=1
6	AFDB:F4II66	0.965	0.885	1.505E-41	355	0.468	0.428	F4II66.pdb.gz	F4II66_ARATH Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana OX=3702 GN=At2g46290 PE=1 SV=1
7	AFDB:Q383W8	0.921	0.876	3.225E-39	342	0.375	0.357	Q383W8.pdb.gz	Q383W8_TRYB2 Eukaryotic translation initiation factor 3 subunit I OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1370 PE=3 SV=1
8	PDB:3zwlD	0.936	0.866	3.663E-39	352	0.462	0.426	3zwlD.pdb.gz
9	AFDB:Q54MT0	0.936	0.919	7.548E-39	331	0.415	0.408	Q54MT0.pdb.gz	EIF3I_DICDI Eukaryotic translation initiation factor 3 subunit I OS=Dictyostelium discoideum OX=44689 GN=eif3I PE=3 SV=1
10	AFDB:Q4Q127	0.898	0.701	9.688E-32	419	0.295	0.229	Q4Q127.pdb.gz	Q4Q127_LEIMA Eukaryotic translation initiation factor 3 subunit I OS=Leishmania major OX=5664 GN=LMJF_36_3880 PE=3 SV=1
11	AFDB:Q9XI22	0.853	0.833	1.288E-26	333	0.243	0.237	Q9XI22.pdb.gz	Q9XI22_ARATH F9L1.42 protein OS=Arabidopsis thaliana OX=3702 GN=XIW1 PE=1 SV=1
12	AFDB:Q9SSS7	0.844	0.801	5.703E-26	343	0.268	0.254	Q9SSS7.pdb.gz	Q9SSS7_ARATH AT1G52730 protein OS=Arabidopsis thaliana OX=3702 GN=At1g52730 PE=1 SV=1
13	PDB:5mzhB	0.693	0.558	9.568E-24	415	0.209	0.164	5mzhB.pdb.gz
14	PDB:2h9lA	0.800	0.810	1.122E-23	321	0.191	0.193	2h9lA.pdb.gz
15	PDB:7pzyh	0.805	0.840	1.658E-21	311	0.191	0.199	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:5nnzA	0.700	0.681	1.065E-20	335	0.209	0.203	5nnzA.pdb.gz
17	PDB:7qdrC	0.782	0.830	1.249E-20	305	0.194	0.207	7qdrC.pdb.gz
18	PDB:5yzgs	0.787	0.689	1.718E-20	374	0.203	0.176	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:5mqfF	0.805	0.849	2.015E-20	307	0.203	0.215	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
20	PDB:3dm0A	0.793	0.393	2.363E-20	675	0.148	0.071	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0BNA7	0.0	682	325	0.994	0.994	EIF3I_RAT Eukaryotic translation initiation factor 3 subunit I OS=Rattus norvegicus OX=10116 GN=Eif3i PE=2 SV=1
2	Q13347	0.0	685	325	1.000	1.000	EIF3I_HUMAN Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens OX=9606 GN=EIF3I PE=1 SV=1
3	Q7ZV55	0.0	593	325	0.837	0.837	EIF3I_DANRE Eukaryotic translation initiation factor 3 subunit I OS=Danio rerio OX=7955 GN=eif3i PE=2 SV=1
4	Q9QZD9	0.0	682	325	0.994	0.994	EIF3I_MOUSE Eukaryotic translation initiation factor 3 subunit I OS=Mus musculus OX=10090 GN=Eif3i PE=1 SV=1
5	P79083	1.02e-111	329	328	0.492	0.488	EIF3I_SCHPO Eukaryotic translation initiation factor 3 subunit I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sum1 PE=1 SV=1
6	F4II66	1.49e-103	309	355	0.471	0.431	F4II66_ARATH Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana OX=3702 GN=At2g46290 PE=1 SV=1
7	P40217	2.44e-100	301	347	0.462	0.432	EIF3I_YEAST Eukaryotic translation initiation factor 3 subunit I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF34 PE=1 SV=1
8	Q38884	3.73e-99	297	328	0.468	0.463	EIF3I_ARATH Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana OX=3702 GN=TIF3I1 PE=2 SV=2
9	Q54MT0	4.96e-95	286	331	0.418	0.411	EIF3I_DICDI Eukaryotic translation initiation factor 3 subunit I OS=Dictyostelium discoideum OX=44689 GN=eif3I PE=3 SV=1
10	Q383W8	3.94e-75	236	342	0.385	0.365	Q383W8_TRYB2 Eukaryotic translation initiation factor 3 subunit I OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1370 PE=3 SV=1
11	Q4Q127	1.15e-43	156	419	0.314	0.243	Q4Q127_LEIMA Eukaryotic translation initiation factor 3 subunit I OS=Leishmania major OX=5664 GN=LMJF_36_3880 PE=3 SV=1
12	Q9XI22	6.99e-27	110	333	0.240	0.234	Q9XI22_ARATH F9L1.42 protein OS=Arabidopsis thaliana OX=3702 GN=XIW1 PE=1 SV=1
13	Q9W1N4	1.86e-24	103	328	0.255	0.253	Q9W1N4_DROME HL01517p OS=Drosophila melanogaster OX=7227 GN=wmd PE=1 SV=1
14	Q9LW17	1.90e-23	100	341	0.258	0.246	Q9LW17_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At3g15610 PE=1 SV=1
15	Q9SSS7	3.19e-22	97.4	343	0.255	0.242	Q9SSS7_ARATH AT1G52730 protein OS=Arabidopsis thaliana OX=3702 GN=At1g52730 PE=1 SV=1
16	Q642N8	7.84e-22	96.3	329	0.255	0.252	Q642N8_XENLA MGC86380 protein OS=Xenopus laevis OX=8355 GN=strap.L PE=2 SV=1
17	Q9Z1Z2	2.14e-18	86.7	350	0.246	0.229	STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus OX=10090 GN=Strap PE=1 SV=2
18	Q8N136	5.08e-18	86.3	415	0.231	0.181	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
19	Q9Y3F4	6.64e-18	85.5	350	0.243	0.226	STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1
20	Q386X0	1.05e-17	84.3	326	0.243	0.242	Q386X0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.42.0004 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	8.3e-11	53.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	0.029	25.0	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF20426 NBCH_WD40	4.4	17.6	Neurobeachin beta propeller domain
4	PF00400 WD40	1.7e-22	90.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008576447.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008564978.1	0.999	Eukaryotic translation initiation factor 3 subunit B
2	482537.XP_008566172.1	0.999	Eukaryotic translation initiation factor 3 subunit M
3	482537.XP_008567955.1	0.999	Eukaryotic translation initiation factor 3 subunit E
4	482537.XP_008572169.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 mRNAs, 9 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008572314.1	0.999	Eukaryotic translation initiation factor 3 subunit J isoform X1
6	482537.XP_008576245.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 13 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008577248.1	0.999	Eukaryotic translation initiation factor 3 subunit C
8	482537.XP_008580176.1	0.999	Eukaryotic translation initiation factor 3 subunit H
9	482537.XP_008582078.1	0.999	Eukaryotic translation initiation factor 3 subunit D
10	482537.XP_008586525.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 11 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008562173.1	0.998	Eukaryotic translation initiation factor 3 subunit A-like
12	482537.XP_008563062.1	0.998	Eukaryotic translation initiation factor 3 subunit L-like
13	482537.XP_008567995.1	0.998	Eukaryotic translation initiation factor 3 subunit L
14	482537.XP_008574533.1	0.998	Eukaryotic translation initiation factor 2 subunit 1
15	482537.XP_008574552.1	0.998	Eukaryotic translation initiation factor 5
16	482537.XP_008574832.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 45 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008579732.1	0.998	Guanine nucleotide-binding protein subunit beta-2-like 1
18	482537.XP_008579861.1	0.998	40S ribosomal protein S2
19	482537.XP_008581096.1	0.998	Eukaryotic translation initiation factor 3 subunit A
20	482537.XP_008592200.1	0.998	40S ribosomal protein S8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	0.999	translation initiation factor activity
GO:0003723	0.457	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034641	0.998	cellular nitrogen compound metabolic process
GO:0010467	0.997	gene expression
GO:0019538	0.997	protein metabolic process
GO:0044260	0.993	cellular macromolecule metabolic process
GO:1901576	0.987	organic substance biosynthetic process
GO:0044249	0.987	cellular biosynthetic process
GO:0044271	0.982	cellular nitrogen compound biosynthetic process
GO:1901566	0.980	organonitrogen compound biosynthetic process
GO:0034645	0.980	cellular macromolecule biosynthetic process
GO:0043603	0.979	amide metabolic process
GO:0043604	0.974	amide biosynthetic process
GO:0006413	0.961	translational initiation
GO:0050789	0.339	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005829	0.983	cytosol
GO:0005852	0.983	eukaryotic translation initiation factor 3 complex
GO:0043226	0.969	organelle
GO:0043227	0.962	membrane-bounded organelle
GO:0031982	0.889	vesicle
GO:0005576	0.888	extracellular region
GO:0043229	0.867	intracellular organelle
GO:0043230	0.856	extracellular organelle
GO:0043231	0.855	intracellular membrane-bounded organelle
GO:0065010	0.838	extracellular membrane-bounded organelle
GO:1903561	0.832	extracellular vesicle
GO:0043232	0.747	intracellular non-membrane-bounded organelle
GO:0070062	0.725	extracellular exosome
GO:0005634	0.454	nucleus
GO:0043233	0.411	organelle lumen
GO:0070013	0.391	intracellular organelle lumen
GO:0031981	0.384	nuclear lumen
GO:0016020	0.300	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]