StarFunc result for job id Q13349

User Input

>input (1161 residues)
MTFGTVLLLSVLASYHGFNLDVEEPTIFQEDAGGFGQSVVQFGGSRLVVGAPLEVVAANQ
TGRLYDCAAATGMCQPIPLHIRPEAVNMSLGLTLAASTNGSRLLACGPTLHRVCGENSYS
KGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQF
EGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQSLVDPIVQLKGLTFTATGILTVVTQLFH
HKNGARKSAKKILIVITDGQKYKDPLEYSDVIPQAEKAGIIRYAIGVGHAFQGPTARQEL
NTISSAPPQDHVFKVDNFAALGSIQKQLQEKIYAVEGTQSRASSSFQHEMSQEGFSTALT
MDGLFLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQNLV
LGAPRYQHTGKAVIFTQVSRQWRKKAEVTGTQIGSYFGASLCSVDVDSDGSTDLILIGAP
HYYEQTRGGQVSVCPLPRGRVQWQCDAVLRGEQGHPWGRFGAALTVLGDVNEDKLIDVAI
GAPGEQENRGAVYLFHGASESGISPSHSQRIASSQLSPRLQYFGQALSGGQDLTQDGLMD
LAVGARGQVLLLRSLPVLKVGVAMRFSPVEVAKAVYRCWEEKPSALEAGDATVCLTIQKS
SLDQLGDIQSSVRFDLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPDCV
EDVVSPIILHLNFSLVREPIPSPQNLRPVLAVGSQDLFTASLPFEKNCGQDGLCEGDLGV
TLSFSGLQTLTVGSSLELNVIVTVWNAGEDSYGTVVSLYYPAGLSHRRVSGAQKQPHQSA
LRLACETVPTEDEGLRSSRCSVNHPIFHEGSNGTFIVTFDVSYKATLGDRMLMRASASSE
NNKASSSKATFQLELPVKYAVYTMISRQEESTKYFNFATSDEKKMKEAEHRYRVNNLSQR
DLAISINFWVPVLLNGVAVWDVVMEAPSQSLPCVSERKPPQHSDFLTQISRSPMLDCSIA
DCLQFRCDVPSFSVQEELDFTLKGNLSFGWVRETLQKKVLVVSVAEITFDTSVYSQLPGQ
EAFMRAQMEMVLEEDEVYNAIPIIMGSSVGALLLLALITATLYKLGFFKRHYKEMLEDKP
EDTATFSGDDFSCVAPNVPLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3k6sC	0.463	0.599	0.000	885	0.517	0.678	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
2	PDB:4nehA	0.502	0.537	0.000	1084	0.613	0.657	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
3	PDB:4nenA	0.491	0.535	0.000	1063	0.606	0.661	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
4	PDB:7uslA	0.474	0.637	0.000	856	0.440	0.597	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
5	AFDB:A0A0G2K4L8	0.524	0.524	0.000	1161	0.642	0.642	A0A0G2K4L8.pdb.gz	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
6	AFDB:F1LP44	0.497	0.497	0.000	1161	0.333	0.333	F1LP44.pdb.gz	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
7	AFDB:P05555	0.526	0.530	0.000	1153	0.556	0.559	P05555.pdb.gz	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
8	AFDB:P11215	0.776	0.781	0.000	1152	0.584	0.589	P11215.pdb.gz	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
9	AFDB:P20701	0.490	0.486	0.000	1170	0.326	0.323	P20701.pdb.gz	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
10	AFDB:P20702	0.515	0.514	0.000	1163	0.653	0.652	P20702.pdb.gz	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
11	AFDB:P24063	0.499	0.498	0.000	1163	0.323	0.322	P24063.pdb.gz	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
12	AFDB:P61625	0.493	0.491	0.000	1165	0.332	0.330	P61625.pdb.gz	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
13	AFDB:Q13349	1.000	1.000	0.000	1161	1.000	1.000	Q13349.pdb.gz	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
14	AFDB:Q3V0T4	0.532	0.529	0.000	1168	0.717	0.713	Q3V0T4.pdb.gz	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
15	PDB:3fcsA	0.414	0.518	3.772E-59	913	0.184	0.234	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:4g1eA	0.410	0.486	4.634E-59	964	0.196	0.237	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:7nxdA	0.456	0.568	8.783E-57	905	0.189	0.243	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
18	PDB:4rtdA	0.087	0.090	2.113E-10	1122	0.052	0.053	4rtdA.pdb.gz
19	PDB:2xwbF	0.157	0.238	3.433E-8	714	0.069	0.112	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
20	PDB:7eebE	0.135	0.146	4.217E-8	1053	0.071	0.078	7eebE.pdb.gz	Structure of a mammalian sperm cation channel complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K4L8	0.0	1335	1151	0.562	0.566	A0A0G2K4L8_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
2	A0A8I5Y8A4	0.0	1303	1141	0.548	0.557	A0A8I5Y8A4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
3	A0A8I5ZVY4	0.0	1078	1088	0.460	0.491	A0A8I5ZVY4_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
4	A0A8I6A686	0.0	606	1034	0.266	0.299	A0A8I6A686_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=1 SV=1
5	G3V8L7	0.0	1330	1151	0.560	0.565	G3V8L7_RAT Integrin subunit alpha M OS=Rattus norvegicus OX=10116 GN=Itgam PE=3 SV=2
6	P05555	0.0	1329	1153	0.563	0.567	ITAM_MOUSE Integrin alpha-M OS=Mus musculus OX=10090 GN=Itgam PE=1 SV=2
7	P11215	0.0	1356	1152	0.588	0.593	ITAM_HUMAN Integrin alpha-M OS=Homo sapiens OX=9606 GN=ITGAM PE=1 SV=2
8	P20702	0.0	1494	1163	0.645	0.644	ITAX_HUMAN Integrin alpha-X OS=Homo sapiens OX=9606 GN=ITGAX PE=1 SV=3
9	Q13349	0.0	2403	1161	1.000	1.000	ITAD_HUMAN Integrin alpha-D OS=Homo sapiens OX=9606 GN=ITGAD PE=1 SV=2
10	Q3V0T4	0.0	1707	1168	0.715	0.711	ITAD_MOUSE Integrin alpha-D OS=Mus musculus OX=10090 GN=Itgad PE=1 SV=1
11	Q9JI30	0.0	1332	1151	0.558	0.563	Q9JI30_RAT Integrin beta 2 alpha subunit OS=Rattus norvegicus OX=10116 GN=Itgam PE=2 SV=1
12	Q9QXH4	0.0	1425	1169	0.606	0.601	ITAX_MOUSE Integrin alpha-X OS=Mus musculus OX=10090 GN=Itgax PE=1 SV=1
13	Q9QYE7	0.0	1741	1161	0.735	0.735	ITAD_RAT Integrin alpha-D OS=Rattus norvegicus OX=10116 GN=Itgad PE=2 SV=1
14	P61625	2.66e-174	546	1165	0.346	0.345	ITAL_BOVIN Integrin alpha-L OS=Bos taurus OX=9913 GN=ITGAL PE=1 SV=1
15	F1LP44	2.95e-166	525	1161	0.339	0.339	F1LP44_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=3
16	Q3T1L6	1.54e-165	523	1160	0.341	0.341	Q3T1L6_RAT Integrin alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=2 SV=1
17	P24063	1.34e-164	521	1162	0.334	0.334	ITAL_MOUSE Integrin alpha-L OS=Mus musculus OX=10090 GN=Itgal PE=1 SV=3
18	P20701	2.20e-164	520	1170	0.340	0.338	ITAL_HUMAN Integrin alpha-L OS=Homo sapiens OX=9606 GN=ITGAL PE=1 SV=3
19	A0A8I5ZT41	2.75e-141	456	1079	0.252	0.271	A0A8I5ZT41_RAT Integrin subunit alpha L OS=Rattus norvegicus OX=10116 GN=Itgal PE=1 SV=1
20	Q60677	5.00e-126	417	1167	0.258	0.256	ITAE_MOUSE Integrin alpha-E OS=Mus musculus OX=10090 GN=Itgae PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12982 DUF3866	1.5e+02	12.9	Protein of unknown function (DUF3866)
2	PF01839 FG-GAP	1.4e-18	77.6	FG-GAP repeat
3	PF13517 FG-GAP_3	0.084	24.8	FG-GAP-like repeat
4	PF00357 Integrin_alpha	0.2	22.7	Integrin alpha cytoplasmic region
5	PF08441 Integrin_alpha2	1.6e-27	108.4	Integrin alpha
6	PF00092 VWA	3.2e-36	136.7	von Willebrand factor type A domain
7	PF13519 VWA_2	2.9e-10	52.1	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380948	0.988	Integrin beta-2
2	9606.ENSP00000294728	0.982	Vascular cell adhesion protein 1
3	9606.ENSP00000283249	0.967	Integrin beta-6
4	9606.ENSP00000222573	0.963	Integrin beta-8
5	9606.ENSP00000267082	0.963	Integrin beta-7
6	9606.ENSP00000296181	0.963	Integrin beta-5
7	9606.ENSP00000379350	0.960	Integrin beta-1
8	9606.ENSP00000452786	0.955	Integrin beta-3
9	9606.ENSP00000160262	0.939	Intercellular adhesion molecule 3
10	9606.ENSP00000264246	0.929	T-lymphocyte activation antigen CD80
11	9606.ENSP00000299106	0.929	Junctional adhesion molecule C
12	9606.ENSP00000327290	0.920	Integrin alpha-11
13	9606.ENSP00000358310	0.920	Integrin alpha-10
14	9606.ENSP00000349252	0.918	Integrin alpha-L
15	9606.ENSP00000367316	0.915	Integrin alpha-8
16	9606.ENSP00000324890	0.912	T-cell-specific surface glycoprotein CD28
17	9606.ENSP00000296585	0.910	Integrin alpha-2
18	9606.ENSP00000380227	0.910	Integrin alpha-4
19	9606.ENSP00000261023	0.908	Integrin alpha-V
20	9606.ENSP00000282588	0.908	Integrin alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	0.999	protein binding
GO:0050839	0.970	cell adhesion molecule binding
GO:0038023	0.952	signaling receptor activity
GO:0005102	0.742	signaling receptor binding
GO:0005178	0.638	integrin binding
GO:0019899	0.531	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0007155	0.990	cell adhesion
GO:0050789	0.935	regulation of biological process
GO:0098609	0.932	cell-cell adhesion
GO:0050794	0.889	regulation of cellular process
GO:0050896	0.873	response to stimulus
GO:0048518	0.843	positive regulation of biological process
GO:0032501	0.802	multicellular organismal process
GO:0048522	0.770	positive regulation of cellular process
GO:0048856	0.692	anatomical structure development
GO:0019222	0.558	regulation of metabolic process
GO:0051716	0.494	cellular response to stimulus
GO:0007154	0.476	cell communication
GO:0051239	0.468	regulation of multicellular organismal process
GO:0048869	0.448	cellular developmental process
GO:0048583	0.448	regulation of response to stimulus
GO:0060255	0.446	regulation of macromolecule metabolic process
GO:0023052	0.444	signaling
GO:0009893	0.420	positive regulation of metabolic process
GO:0002376	0.406	immune system process
GO:0031589	0.406	cell-substrate adhesion
GO:0010604	0.406	positive regulation of macromolecule metabolic process
GO:0007165	0.404	signal transduction
GO:0030154	0.386	cell differentiation
GO:0007275	0.364	multicellular organism development
GO:0009653	0.360	anatomical structure morphogenesis
GO:0051240	0.359	positive regulation of multicellular organismal process
GO:0009888	0.327	tissue development
GO:0048584	0.303	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	0.999	cell surface
GO:0008305	0.998	integrin complex
GO:0043227	0.974	membrane-bounded organelle
GO:0005622	0.920	intracellular anatomical structure
GO:0012505	0.912	endomembrane system
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0070062	0.895	extracellular exosome
GO:0005737	0.885	cytoplasm
GO:0031410	0.817	cytoplasmic vesicle
GO:0030141	0.640	secretory granule
GO:0030659	0.610	cytoplasmic vesicle membrane
GO:0098588	0.510	bounding membrane of organelle
GO:0030054	0.420	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]