StarFunc result for job id Q13360

User Input

>input (481 residues)
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQKNLYKDVMLENFRNLASVGYQLCRH
SLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTAENQPGEH
SLECNHCGKFRKNTRFICTRYCKGEKCYKYIKYSKVFNHPSTLRSHVSIHIGEKTLEFTD
CRKAFNQESSLRKHLRTPTGQKFQEYEQCDMSFSLHSSCSVREQIPTGEKGDECSDYGKI
SPLSVHTKTGSVEEGLECNEHEKTFTDPLSLQNCVRTHSGEMPYECSDCGKAFIFQSSLK
KHMRSHTGEKPYECDHCGKSFSQSSHLNVHKRTHTGEKPYDCKECGKAFTVPSSLQKHVR
THTGEKPYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSYLIVHKRTHTG
EKTYECKECGKAFRNSSCLRVHVRTHTGEKPYKCIQCEKAFSTSTNLIMHKRIHNGQKLH
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13360	1.000	1.000	3.160E-85	481	1.000	1.000	Q13360.pdb.gz	ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens OX=9606 GN=ZNF177 PE=1 SV=4
2	AFDB:Q9BUY5	0.275	0.242	4.406E-37	554	0.416	0.361	Q9BUY5.pdb.gz	ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens OX=9606 GN=ZNF426 PE=1 SV=1
3	AFDB:Q96NG5	0.440	0.523	1.116E-36	402	0.410	0.490	Q96NG5.pdb.gz	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
4	AFDB:P21506	0.366	0.316	1.254E-36	573	0.414	0.347	P21506.pdb.gz	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
5	AFDB:Q32M78	0.249	0.189	1.777E-36	642	0.472	0.354	Q32M78.pdb.gz	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
6	AFDB:Q5DTF8	0.361	0.204	2.242E-36	919	0.405	0.212	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
7	AFDB:Q06732	0.428	0.272	2.376E-36	778	0.397	0.246	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
8	AFDB:Q96JL9	0.379	0.285	2.518E-36	665	0.435	0.314	Q96JL9.pdb.gz	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
9	AFDB:Q9HCZ1	0.423	0.306	2.669E-36	680	0.397	0.281	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
10	AFDB:P17030	0.408	0.429	3.367E-36	456	0.410	0.432	P17030.pdb.gz	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
11	PDB:3w5kB	0.095	0.270	6.380E-5	110	0.091	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.056	0.108	2.097	208	0.060	0.139	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:7kkfA	0.050	0.139	2.355	162	0.012	0.037	7kkfA.pdb.gz
14	PDB:7uhyC	0.059	0.053	2.355	578	0.040	0.033	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7odrg	0.059	0.139	2.971	134	0.029	0.104	7odrg.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
16	PDB:4kfzB	0.065	0.142	3.149	148	0.050	0.162	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
17	PDB:6vk0C	0.075	0.145	3.149	180	0.021	0.056	6vk0C.pdb.gz
18	PDB:6hlqI	0.045	0.120	3.337	111	0.029	0.126	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
19	PDB:3gn5A	0.052	0.111	3.537	132	0.008	0.030	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
20	PDB:7l08AF	0.064	0.103	3.537	208	0.035	0.082	7l08AF.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13360	0.0	1002	481	1.000	1.000	ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens OX=9606 GN=ZNF177 PE=1 SV=4
2	Q147U1	1.74e-130	390	533	0.476	0.430	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2
3	Q9BUY5	1.67e-128	386	554	0.457	0.397	ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens OX=9606 GN=ZNF426 PE=1 SV=1
4	Q96PQ6	1.60e-125	379	595	0.457	0.370	ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2
5	Q61491	1.81e-125	378	546	0.474	0.418	Q61491_MOUSE DNA-binding protein OS=Mus musculus OX=10090 GN=Zfp97 PE=2 SV=1
6	E9PZP6	2.94e-124	375	546	0.472	0.416	E9PZP6_MOUSE Zinc finger protein 97 OS=Mus musculus OX=10090 GN=Zfp97 PE=4 SV=1
7	A0A0U1RQ46	1.84e-123	375	609	0.470	0.371	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
8	Q96JL9	1.42e-121	372	665	0.445	0.322	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
9	Q9BR84	2.91e-119	362	538	0.464	0.414	ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens OX=9606 GN=ZNF559 PE=1 SV=1
10	E9QAG8	8.15e-118	357	526	0.441	0.403	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
11	Q8N9F8	3.79e-115	350	522	0.449	0.414	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
12	Q8TC21	1.68e-114	348	504	0.445	0.425	ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens OX=9606 GN=ZNF596 PE=1 SV=2
13	Q3KP31	1.81e-114	350	576	0.447	0.373	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
14	P17030	1.94e-114	346	456	0.424	0.447	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
15	Q9C0F3	2.19e-114	347	470	0.422	0.432	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
16	Q8IYB9	5.00e-114	352	648	0.451	0.335	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
17	Q8NEP9	6.35e-114	351	628	0.432	0.331	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
18	Q8NA42	6.76e-114	346	475	0.428	0.434	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
19	Q32M78	2.75e-113	349	642	0.443	0.332	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
20	Q8TAQ5	1.09e-112	349	688	0.441	0.308	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12552 DUF3741	1.8e+02	13.4	Protein of unknown function (DUF3741)
2	PF20026 DUF6434	2.6e+02	13.0	Domain of unknown function (DUF6434)
3	PF07754 HVO_2753_ZBP	55	15.0	Small zinc finger protein HVO_2753-like, Zn-binding pocket
4	PF01352 KRAB	8.8e-23	91.0	KRAB box
5	PF01286 XPA_N	0.016	26.6	XPA protein N-terminal
6	PF14149 YhfH	1.7e+02	13.5	YhfH-like protein
7	PF00096 zf-C2H2	2e-45	161.9	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	0.00028	31.9	zinc-finger C2H2-type
9	PF13894 zf-C2H2_4	6.9e-22	87.2	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	3.9e-15	66.7	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	6.3e-12	56.7	Zinc-finger double-stranded RNA-binding
12	PF13913 zf-C2HC_2	3.3e+02	12.6	zinc-finger of a C2HC-type
13	PF13465 zf-H2C2_2	3.2e-65	225.1	Zinc-finger double domain
14	PF08790 zf-LYAR	2e+02	13.3	LYAR-type C2HC zinc finger
15	PF12874 zf-met	2.6	19.8	Zinc-finger of C2H2 type
16	PF13451 zf-trcl	85	14.5	Probable zinc-ribbon domain
17	PF18439 zf_UBZ	0.23	22.5	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	33	16.6	zinc-ribbon family
19	PF09723 Zn-ribbon_8	18	16.9	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	41	15.6	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468531

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000291842	0.909	SH3KBP1-binding protein 1
2	9606.ENSP00000263093	0.783	Bile acyl-CoA synthetase
3	9606.ENSP00000386764	0.611	Zinc finger CCCH-type containing 6
4	9606.ENSP00000355437	0.572	E3 ubiquitin-protein ligase TRIM58
5	9606.ENSP00000353796	0.530	Ankyrin repeat domain-containing protein 53
6	9606.ENSP00000221856	0.521	Fibronectin type III and SPRY domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0009889	0.947	regulation of biosynthetic process
GO:0051252	0.911	regulation of RNA metabolic process
GO:0006355	0.888	regulation of DNA-templated transcription
GO:0009987	0.566	cellular process
GO:0048519	0.535	negative regulation of biological process
GO:0048523	0.514	negative regulation of cellular process
GO:1902679	0.449	negative regulation of RNA biosynthetic process
GO:0045892	0.439	negative regulation of DNA-templated transcription
GO:0006357	0.433	regulation of transcription by RNA polymerase II
GO:0048518	0.337	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005737	0.848	cytoplasm
GO:0031981	0.679	nuclear lumen
GO:0005576	0.580	extracellular region
GO:0016020	0.475	membrane
GO:0043228	0.462	non-membrane-bounded organelle
GO:0005615	0.374	extracellular space
GO:0043232	0.317	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]