StarFunc result for job id Q13362

User Input

>input (524 residues)
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13362	1.000	1.000	4.910E-64	524	1.000	1.000	Q13362.pdb.gz	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
2	AFDB:Q499R1	0.869	0.735	2.292E-50	622	0.782	0.659	Q499R1.pdb.gz	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
3	AFDB:Q8IN89	0.841	0.450	2.016E-46	984	0.685	0.365	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
4	AFDB:A0A0B4KHB9	0.823	0.604	5.844E-45	716	0.681	0.499	A0A0B4KHB9.pdb.gz	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
5	AFDB:A9UJN4	0.822	0.712	4.874E-43	607	0.628	0.542	A9UJN4.pdb.gz	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
6	AFDB:A4FV68	0.780	0.874	3.614E-41	467	0.584	0.655	A4FV68.pdb.gz	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
7	AFDB:Q9VB23	0.776	0.776	7.032E-41	524	0.590	0.590	Q9VB23.pdb.gz	Q9VB23_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wdb PE=1 SV=2
8	AFDB:Q6DFL3	0.779	0.856	2.993E-40	476	0.565	0.622	Q6DFL3.pdb.gz	Q6DFL3_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5b.L PE=2 SV=1
9	AFDB:Q15172	0.773	0.832	4.257E-40	486	0.578	0.623	Q15172.pdb.gz	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
10	AFDB:Q15173	0.788	0.830	8.613E-40	497	0.561	0.592	Q15173.pdb.gz	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
11	PDB:6ntsB	0.653	0.938	4.488E-30	361	0.521	0.756	6ntsB.pdb.gz	Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
12	PDB:5tbkA	0.291	0.343	1.735E-4	417	0.111	0.139	5tbkA.pdb.gz
13	PDB:3tpoA	0.308	0.348	7.678E-4	438	0.095	0.114	3tpoA.pdb.gz
14	PDB:3w3zA	0.440	0.254	9.711E-4	1013	0.120	0.062	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
15	PDB:1b3uA	0.315	0.288	1.381E-3	588	0.095	0.085	1b3uA.pdb.gz
16	PDB:3w3uA	0.409	0.237	1.615E-3	1030	0.107	0.054	3w3uA.pdb.gz
17	PDB:4jlqA	0.362	0.252	2.043E-3	840	0.111	0.069	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:1wa5B	0.326	0.356	2.298E-3	466	0.109	0.122	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
19	PDB:6xu2A	0.378	0.208	2.298E-3	1091	0.092	0.044	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:7wttK	0.390	0.221	2.485E-3	1022	0.095	0.049	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHB9	729	716	0.672	0.492	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
2	A0A0B4KHP7	705	683	0.622	0.477	A0A0B4KHP7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
3	A0A8I6A6K6	845	671	0.773	0.604	A0A8I6A6K6_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=1
4	A4FV68	601	467	0.546	0.612	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
5	A9UJN4	677	607	0.618	0.534	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
6	B7Z0L6	728	703	0.672	0.501	B7Z0L6_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
7	B7Z0L7	642	438	0.567	0.678	B7Z0L7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
8	F1MAA3	837	592	0.769	0.681	F1MAA3_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=3
9	O18178	589	542	0.548	0.530	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
10	Q0KI58	704	670	0.622	0.487	Q0KI58_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	Q13362	1085	524	1.000	1.000	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
12	Q14738	842	602	0.771	0.671	2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1
13	Q15172	604	486	0.542	0.584	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
14	Q15173	581	497	0.546	0.575	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
15	Q16537	601	467	0.546	0.612	2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1
16	Q499R1	845	622	0.773	0.651	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
17	Q5BIJ2	703	656	0.622	0.497	Q5BIJ2_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
18	Q5XH34	591	467	0.536	0.602	Q5XH34_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5e.S PE=1 SV=1
19	Q60996	1050	524	0.968	0.968	2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp2r5c PE=1 SV=2
20	Q61151	600	467	0.546	0.612	2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Mus musculus OX=10090 GN=Ppp2r5e PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01603 B56	2.4e-185	628.1	Protein phosphatase 2A regulatory B subunit (B56 family)
2	PF15515 MvaI_BcnI	1.8e+02	13.4	MvaI/BcnI restriction endonuclease family
3	PF12783 Sec7_N	4.6e+02	12.1	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019153

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009847	0.999	Protein phosphatase 2, catalytic subunit, alpha isozyme
2	61853.ENSNLEP00000007292	0.998	Protein phosphatase 2, regulatory subunit A, alpha
3	61853.ENSNLEP00000014569	0.982	Protein phosphatase 2, catalytic subunit, beta isozyme
4	61853.ENSNLEP00000019652	0.980	Protein phosphatase 2, regulatory subunit B, alpha
5	61853.ENSNLEP00000021415	0.942	Serine/threonine-protein phosphatase 2A activator
6	61853.ENSNLEP00000003868	0.938	Protein phosphatase 1, catalytic subunit, gamma isozyme
7	61853.ENSNLEP00000018622	0.937	Protein phosphatase 1, catalytic subunit, beta isozyme
8	61853.ENSNLEP00000008867	0.934	Protein phosphatase 2, regulatory subunit A, beta
9	61853.ENSNLEP00000020963	0.923	Protein phosphatase 4, regulatory subunit 4
10	61853.ENSNLEP00000003456	0.921	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
11	61853.ENSNLEP00000007753	0.905	Protein phosphatase 1, catalytic subunit, alpha isozyme
12	61853.ENSNLEP00000020260	0.904	Protein phosphatase 3, catalytic subunit, beta isozyme
13	61853.ENSNLEP00000024305	0.904	Protein phosphatase 3, catalytic subunit, alpha isozyme
14	61853.ENSNLEP00000012174	0.880	annotation not available
15	61853.ENSNLEP00000006189	0.873	Protein phosphatase 1, regulatory subunit 12A
16	61853.ENSNLEP00000011861	0.869	Cellular tumor antigen p53
17	61853.ENSNLEP00000001898	0.867	Protein phosphatase 2, regulatory subunit B, delta
18	61853.ENSNLEP00000004271	0.865	Shugoshin-like 1 (S. pombe)
19	61853.ENSNLEP00000018949	0.865	SHOC2, leucine rich repeat scaffold protein
20	61853.ENSNLEP00000008656	0.861	WD repeat domain 82

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019888	0.801	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0044237	0.921	cellular metabolic process
GO:0050896	0.892	response to stimulus
GO:0071704	0.876	organic substance metabolic process
GO:0044238	0.859	primary metabolic process
GO:0006807	0.791	nitrogen compound metabolic process
GO:0043170	0.748	macromolecule metabolic process
GO:0048519	0.717	negative regulation of biological process
GO:1901564	0.713	organonitrogen compound metabolic process
GO:0048523	0.692	negative regulation of cellular process
GO:0019538	0.681	protein metabolic process
GO:0051716	0.654	cellular response to stimulus
GO:0007154	0.648	cell communication
GO:0023052	0.640	signaling
GO:0032502	0.507	developmental process
GO:0048518	0.469	positive regulation of biological process
GO:0032501	0.456	multicellular organismal process
GO:0007049	0.445	cell cycle
GO:0048522	0.443	positive regulation of cellular process
GO:0022402	0.441	cell cycle process
GO:0048856	0.428	anatomical structure development
GO:0019222	0.326	regulation of metabolic process
GO:0007165	0.317	signal transduction
GO:0007275	0.311	multicellular organism development
GO:0060255	0.308	regulation of macromolecule metabolic process
GO:0031323	0.307	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005634	0.978	nucleus
GO:0005829	0.929	cytosol
GO:0032991	0.731	protein-containing complex
GO:0031974	0.473	membrane-enclosed lumen
GO:0043233	0.439	organelle lumen
GO:0070013	0.411	intracellular organelle lumen
GO:0031981	0.369	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]