StarFunc result for job id Q13363

User Input

>input (440 residues)
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA
PSPGQTVKPEADRDHASDQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88712	0.811	0.809	1.156E-83	441	0.989	0.986	O88712.pdb.gz	CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus OX=10090 GN=Ctbp1 PE=1 SV=2
2	AFDB:Q7ZU55	0.794	0.778	4.284E-75	449	0.800	0.784	Q7ZU55.pdb.gz	Q7ZU55_DANRE C-terminal binding protein 1 OS=Danio rerio OX=7955 GN=wu:fi43a11 PE=1 SV=1
3	AFDB:P56545	0.793	0.785	1.338E-73	445	0.784	0.775	P56545.pdb.gz	CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1
4	AFDB:A9UL56	0.786	0.492	6.242E-72	710	0.773	0.479	A9UL56.pdb.gz
5	AFDB:A0A2R8QBA1	0.784	0.294	9.474E-67	1200	0.723	0.265	A0A2R8QBA1.pdb.gz
6	AFDB:Q5BU17	0.769	0.395	1.063E-66	860	0.716	0.366	Q5BU17.pdb.gz	Q5BU17_DANRE C-terminal-binding protein 2 OS=Danio rerio OX=7955 GN=ctbp2l PE=2 SV=1
7	AFDB:O46036	0.798	0.738	1.153E-62	476	0.607	0.561	O46036.pdb.gz	CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster OX=7227 GN=CtBP PE=1 SV=3
8	AFDB:Q20595	0.765	0.468	4.201E-52	727	0.461	0.279	Q20595.pdb.gz	CTBP1_CAEEL C-terminal-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ctbp-1 PE=1 SV=3
9	AFDB:O08651	0.660	0.550	3.955E-31	533	0.227	0.188	O08651.pdb.gz	SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Phgdh PE=1 SV=3
10	AFDB:P9WNX3	0.624	0.527	6.627E-31	528	0.234	0.195	P9WNX3.pdb.gz	SERA_MYCTU D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serA PE=1 SV=1
11	PDB:1ygyA	0.598	0.508	7.478E-29	527	0.232	0.194	1ygyA.pdb.gz
12	PDB:5z1zC	0.589	0.791	4.648E-27	316	0.198	0.275	5z1zC.pdb.gz
13	PDB:3jtmA	0.615	0.755	5.521E-27	351	0.173	0.217	3jtmA.pdb.gz	Structure of recombinant formate dehydrogenase from Arabidopsis thaliana
14	PDB:2p9eA	0.554	0.594	6.503E-26	406	0.182	0.197	2p9eA.pdb.gz	The Effect of Hinge Mutations on Effector Binding and Domain Rotation in Escherichia coli D-3-Phosphoglycerate Dehydrogenase
15	PDB:2gcgA	0.647	0.868	7.293E-26	324	0.177	0.241	2gcgA.pdb.gz	Structural basis of substrate specificity in human glyoxylate reductase/hydroxypyruvate reductase
16	PDB:7wn9B	0.604	0.759	6.830E-25	341	0.177	0.229	7wn9B.pdb.gz
17	PDB:3ba1A	0.635	0.878	1.440E-24	312	0.168	0.237	3ba1A.pdb.gz
18	PDB:2fssA	0.656	0.807	7.596E-24	353	0.195	0.244	2fssA.pdb.gz
19	PDB:5mh5A	0.576	0.796	2.683E-23	308	0.173	0.247	5mh5A.pdb.gz	Productive ternary complexes of D-2-hydroxyacid dehydrogenase provide insights into the chiral specificity of its reaction mechanism
20	PDB:1sc6D	0.462	0.516	3.375E-23	384	0.177	0.203	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y8U5	0.0	873	430	0.970	0.993	H0Y8U5_HUMAN C-terminal binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=2
2	H0Y8W7	0.0	513	287	0.600	0.920	H0Y8W7_HUMAN C-terminal binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=1
3	O46036	0.0	542	476	0.582	0.538	CTBP_DROME C-terminal-binding protein OS=Drosophila melanogaster OX=7227 GN=CtBP PE=1 SV=3
4	O88712	0.0	893	441	0.989	0.986	CTBP1_MOUSE C-terminal-binding protein 1 OS=Mus musculus OX=10090 GN=Ctbp1 PE=1 SV=2
5	P56545	0.0	743	445	0.784	0.775	CTBP2_HUMAN C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1
6	P56546	0.0	740	445	0.782	0.773	CTBP2_MOUSE C-terminal-binding protein 2 OS=Mus musculus OX=10090 GN=Ctbp2 PE=1 SV=2
7	Q0VCQ1	0.0	743	445	0.786	0.778	CTBP2_BOVIN C-terminal-binding protein 2 OS=Bos taurus OX=9913 GN=CTBP2 PE=1 SV=1
8	Q13363	0.0	904	440	1.000	1.000	CTBP1_HUMAN C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1 PE=1 SV=2
9	Q5BU17	0.0	672	860	0.714	0.365	Q5BU17_DANRE C-terminal-binding protein 2 OS=Danio rerio OX=7955 GN=ctbp2l PE=2 SV=1
10	Q5BU19	0.0	678	1147	0.720	0.276	Q5BU19_DANRE C-terminal-binding protein 2 isoform 1 OS=Danio rerio OX=7955 GN=wu:fb96g03 PE=1 SV=1
11	Q5ZIZ6	0.0	851	430	0.936	0.958	Q5ZIZ6_CHICK C-terminal binding protein 1 OS=Gallus gallus OX=9031 GN=CTBP1 PE=1 SV=1
12	Q7ZU55	0.0	724	449	0.789	0.773	Q7ZU55_DANRE C-terminal binding protein 1 OS=Danio rerio OX=7955 GN=wu:fi43a11 PE=1 SV=1
13	Q9DEG6	0.0	721	444	0.770	0.764	Q9DEG6_DANRE C-terminal-binding protein 2 isoform 2 OS=Danio rerio OX=7955 GN=CtBP2 PE=1 SV=1
14	Q9Z2F5	0.0	866	430	0.957	0.979	CTBP1_RAT C-terminal-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ctbp1 PE=1 SV=3
15	X5D8Y5	0.0	904	440	1.000	1.000	X5D8Y5_HUMAN C-terminal binding protein 1 isoform C (Fragment) OS=Homo sapiens OX=9606 GN=CTBP1 PE=2 SV=1
16	Q20595	1.37e-133	403	727	0.432	0.261	CTBP1_CAEEL C-terminal-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ctbp-1 PE=1 SV=3
17	P9WNX3	5.92e-38	146	528	0.220	0.184	SERA_MYCTU D-3-phosphoglycerate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=serA PE=1 SV=1
18	Q61753	2.36e-37	145	533	0.220	0.182	SERA_MOUSE D-3-phosphoglycerate dehydrogenase OS=Mus musculus OX=10090 GN=Phgdh PE=1 SV=3
19	O43175	4.37e-37	144	533	0.218	0.180	SERA_HUMAN D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4
20	O08651	6.75e-37	143	533	0.218	0.180	SERA_RAT D-3-phosphoglycerate dehydrogenase OS=Rattus norvegicus OX=10116 GN=Phgdh PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00389 2-Hacid_dh	4.5e-26	102.5	D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
2	PF02826 2-Hacid_dh_C	2.2e-52	188.5	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
3	PF03500 Cellsynth_D	2.4e+02	13.0	Cellulose synthase subunit D
4	PF03446 NAD_binding_2	0.17	23.5	NAD binding domain of 6-phosphogluconate dehydrogenase
5	PF13478 XdhC_C	1.6e+02	14.2	XdhC Rossmann domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354487	0.999	Zinc finger E-box-binding homeobox 1
2	9606.ENSP00000362649	0.999	Histone deacetylase 1
3	9606.ENSP00000382628	0.999	DNA endonuclease RBBP8
4	9606.ENSP00000383042	0.999	Lysine-specific histone demethylase 1A
5	9606.ENSP00000262241	0.997	REST corepressor 1
6	9606.ENSP00000454157	0.995	Zinc finger E-box-binding homeobox 2
7	9606.ENSP00000314080	0.994	Hypermethylated in cancer 1 protein
8	9606.ENSP00000344456	0.993	Catenin beta-1
9	9606.ENSP00000430432	0.993	Histone deacetylase 2
10	9606.ENSP00000269397	0.992	E3 SUMO-protein ligase CBX4
11	9606.ENSP00000360526	0.992	Zinc finger protein 217
12	9606.ENSP00000327959	0.991	Homeobox protein TGIF1
13	9606.ENSP00000270722	0.990	PR domain zinc finger protein 16
14	9606.ENSP00000331614	0.989	DNA-binding protein Ikaros
15	9606.ENSP00000362010	0.988	Annexin A7
16	9606.ENSP00000380034	0.985	Zinc finger protein SNAI2
17	9606.ENSP00000264674	0.983	MDS1 and EVI1 complex locus protein EVI1
18	9606.ENSP00000257430	0.981	Adenomatous polyposis coli protein
19	9606.ENSP00000418960	0.981	Breast cancer type 1 susceptibility protein
20	9606.ENSP00000386200	0.979	Forkhead box protein P2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	0.998	transcription corepressor activity
GO:0140297	0.998	DNA-binding transcription factor binding
GO:0042802	0.993	identical protein binding
GO:0003824	0.917	catalytic activity
GO:0001221	0.841	transcription coregulator binding
GO:0016614	0.787	oxidoreductase activity, acting on CH-OH group of donors
GO:0019904	0.783	protein domain specific binding
GO:0097159	0.769	organic cyclic compound binding
GO:1901363	0.768	heterocyclic compound binding
GO:0003682	0.714	chromatin binding
GO:0061629	0.695	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016616	0.391	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0019899	0.379	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0019222	0.856	regulation of metabolic process
GO:0060255	0.832	regulation of macromolecule metabolic process
GO:0080090	0.792	regulation of primary metabolic process
GO:0031323	0.792	regulation of cellular metabolic process
GO:0010468	0.789	regulation of gene expression
GO:0051171	0.777	regulation of nitrogen compound metabolic process
GO:0048519	0.735	negative regulation of biological process
GO:0019219	0.732	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.705	response to stimulus
GO:0031326	0.635	regulation of cellular biosynthetic process
GO:1903506	0.627	regulation of nucleic acid-templated transcription
GO:0016043	0.575	cellular component organization
GO:0006355	0.572	regulation of DNA-templated transcription
GO:0048523	0.559	negative regulation of cellular process
GO:0048518	0.518	positive regulation of biological process
GO:0010605	0.496	negative regulation of macromolecule metabolic process
GO:0051716	0.484	cellular response to stimulus
GO:0051172	0.464	negative regulation of nitrogen compound metabolic process
GO:0031324	0.464	negative regulation of cellular metabolic process
GO:0048522	0.437	positive regulation of cellular process
GO:0071704	0.417	organic substance metabolic process
GO:0006357	0.370	regulation of transcription by RNA polymerase II
GO:0045892	0.365	negative regulation of DNA-templated transcription
GO:0009893	0.347	positive regulation of metabolic process
GO:0010604	0.336	positive regulation of macromolecule metabolic process
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0000122	0.324	negative regulation of transcription by RNA polymerase II
GO:0032502	0.317	developmental process
GO:0007154	0.314	cell communication
GO:0023052	0.312	signaling
GO:0031325	0.306	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.943	protein-containing complex
GO:0005737	0.720	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.-.-	0.787	Acting on the CH-OH group of donors.
EC:1.1.1.-	0.391	With NAD(+) or NADP(+) as acceptor.

[back to server]