StarFunc result for job id Q13367

User Input

>input (1082 residues)
MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKRHDDLKEMLDTNKDSLKLEAMKR
IVAMIARGKNASDLFPAVVKNVACKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRGLK
DPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLYSLDSDQK
DQLIEVIEKLLADKTTLVAGSVVMAFEEVCPERIDLIHKNYRKLCNLLIDVEEWGQVVII
SMLTRYARTQFLSPTQNESLLEENAEKAFYGSEEDEAKGAGSEETAAAAAPSRKPYVMDP
DHRLLLRNTKPLLQSRSAAVVMAVAQLYFHLAPKAEVGVIAKALVRLLRSHSEVQYVVLQ
NVATMSIKRRGMFEPYLKSFYIRSTDPTQIKILKLEVLTNLANETNIPTVLREFQTYIRS
MDKDFVAATIQAIGRCATNIGRVRDTCLNGLVQLLSNRDELVVAESVVVIKKLLQMQPAQ
HGEIIKHLAKLTDNIQVPMARASILWLIGEYCEHVPRIAPDVLRKMAKSFTAEEDIVKLQ
VINLAAKLYLTNSKQTKLLTQYVLSLAKYDQNYDIRDRARFTRQLIVPSEQGGALSRHAK
KLFLAPKPAPVLESSFKDRDHFQLGSLSHLLNAKATGYQELPDWPEEAPDPSVRNVEVPE
WTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDN
EDQDEDEEKGRGSESEQSEEDGKRKTKKKVPERKGEASSSDEGSDSSSSSSESEMTSESE
EEQLEPASWSRKTPPSSKSAPATKEISLLDLEDFTPPSVQPVSPPAIVSTSLAADLEGLT
LTDSTLVPSLLSPVSGVGRQELLHRVAGEGLAVDYTFSRQPFSGDPHMVSVHIHFSNSSD
TPIKGLHVGTPKLPAGISIQEFPEIESLAPGESATAVMGINFCDSTQAANFQLCTQTRQF
YVSIQPPVGELMAPVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHIVVQKVTATAN
LGRVPCGTSDEYRFAGRTLTGGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQAL
TQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13367	1.000	1.000	0.000	1082	1.000	1.000	Q13367.pdb.gz	AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens OX=9606 GN=AP3B2 PE=1 SV=2
2	AFDB:Q9Z1T1	0.618	0.606	1.081E-88	1105	0.634	0.621	Q9Z1T1.pdb.gz	AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap3b1 PE=1 SV=2
3	AFDB:O45718	0.521	0.591	3.230E-58	945	0.366	0.419	O45718.pdb.gz	O45718_CAEEL AP-3 complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-3 PE=1 SV=3
4	AFDB:Q556J8	0.529	0.517	1.940E-57	1108	0.359	0.350	Q556J8.pdb.gz	AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum OX=44689 GN=ap3b-1 PE=3 SV=1
5	AFDB:F4IWW1	0.512	0.497	2.460E-46	1115	0.294	0.285	F4IWW1.pdb.gz	F4IWW1_ARATH AP-3 complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=PAT2 PE=1 SV=1
6	AFDB:A0A2R8Q6M9	0.479	0.529	8.050E-37	976	0.218	0.242	A0A2R8Q6M9.pdb.gz
7	AFDB:Q9N4F3	0.474	0.534	6.215E-36	955	0.226	0.255	Q9N4F3.pdb.gz	Q9N4F3_CAEEL AP complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-1 PE=1 SV=2
8	AFDB:A5PMS9	0.513	0.580	1.636E-35	947	0.222	0.253	A5PMS9.pdb.gz	A5PMS9_DANRE AP complex subunit beta OS=Danio rerio OX=7955 GN=fa11e04 PE=1 SV=1
9	AFDB:Q24253	0.465	0.541	2.342E-35	921	0.222	0.261	Q24253.pdb.gz	Q24253_DROME AP complex subunit beta OS=Drosophila melanogaster OX=7227 GN=AP-1-2beta PE=1 SV=1
10	AFDB:Q3ZB97	0.510	0.573	4.157E-35	951	0.225	0.256	Q3ZB97.pdb.gz	Q3ZB97_RAT AP complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1
11	PDB:7p3xB	0.368	0.586	1.366E-17	621	0.148	0.258	7p3xB.pdb.gz
12	PDB:6yafB	0.447	0.788	1.693E-17	579	0.164	0.306	6yafB.pdb.gz	Architecture of the AP2/clathrin coat on the membranes of clathrin-coated vesicles.
13	PDB:5a1uE	0.337	0.421	1.115E-14	824	0.116	0.153	5a1uE.pdb.gz
14	PDB:5a1uG	0.195	0.241	1.710E-9	813	0.113	0.150	5a1uG.pdb.gz
15	PDB:5nzrG	0.311	0.398	4.191E-9	798	0.112	0.152	5nzrG.pdb.gz
16	PDB:1b3uA	0.222	0.359	5.346E-8	588	0.073	0.134	1b3uA.pdb.gz
17	PDB:7p3xA	0.343	0.588	1.567E-7	576	0.069	0.130	7p3xA.pdb.gz
18	PDB:4jlqA	0.244	0.292	5.907E-7	840	0.090	0.115	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
19	PDB:3w3uA	0.244	0.253	1.347E-6	1030	0.063	0.066	3w3uA.pdb.gz
20	PDB:1qgkA	0.222	0.261	2.226E-6	876	0.081	0.100	1qgkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K586	0.0	1033	1094	0.471	0.466	A8K586_HUMAN AP-3 complex subunit beta OS=Homo sapiens OX=9606 PE=2 SV=1
2	O00203	0.0	1033	1094	0.472	0.467	AP3B1_HUMAN AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1 PE=1 SV=3
3	O45718	0.0	642	945	0.304	0.348	O45718_CAEEL AP-3 complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-3 PE=1 SV=3
4	O62348	0.0	648	935	0.304	0.352	O62348_CAEEL AP-3 complex subunit beta OS=Caenorhabditis elegans OX=6239 GN=apb-3 PE=1 SV=3
5	O77290	0.0	892	1160	0.409	0.381	O77290_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=2 SV=1
6	Q13367	0.0	2227	1082	1.000	1.000	AP3B2_HUMAN AP-3 complex subunit beta-2 OS=Homo sapiens OX=9606 GN=AP3B2 PE=1 SV=2
7	Q3MNE1	0.0	1037	800	0.472	0.639	Q3MNE1_HUMAN Adaptor-related protein complex 3 beta 1 subunit (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q556J8	0.0	578	1108	0.286	0.279	AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum OX=44689 GN=ap3b-1 PE=3 SV=1
9	Q7YU20	0.0	890	1159	0.409	0.381	Q7YU20_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=2 SV=1
10	Q9JME5	0.0	1411	1082	0.628	0.628	AP3B2_MOUSE AP-3 complex subunit beta-2 OS=Mus musculus OX=10090 GN=Ap3b2 PE=1 SV=2
11	Q9W4K1	0.0	892	1160	0.409	0.381	Q9W4K1_DROME AP-3 complex subunit beta OS=Drosophila melanogaster OX=7227 GN=rb PE=1 SV=1
12	Q9Z1T1	0.0	1259	1105	0.624	0.611	AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap3b1 PE=1 SV=2
13	F4IWW1	2.53e-115	385	1115	0.253	0.246	F4IWW1_ARATH AP-3 complex subunit beta OS=Arabidopsis thaliana OX=3702 GN=PAT2 PE=1 SV=1
14	Q383L4	5.37e-110	366	918	0.219	0.258	Q383L4_TRYB2 AP-3 complex subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2420 PE=3 SV=1
15	O13939	4.10e-99	332	745	0.199	0.289	AP3B_SCHPO AP-3 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=apl6 PE=1 SV=1
16	P62944	6.92e-76	271	937	0.174	0.201	AP2B1_RAT AP-2 complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1
17	P63010	6.92e-76	271	937	0.174	0.201	AP2B1_HUMAN AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1 PE=1 SV=1
18	Q9DBG3	6.98e-76	271	937	0.174	0.201	AP2B1_MOUSE AP-2 complex subunit beta OS=Mus musculus OX=10090 GN=Ap2b1 PE=1 SV=1
19	Q3ZB97	7.67e-76	272	951	0.174	0.198	Q3ZB97_RAT AP complex subunit beta OS=Rattus norvegicus OX=10116 GN=Ap2b1 PE=1 SV=1
20	Q24253	1.28e-72	262	921	0.181	0.213	Q24253_DROME AP complex subunit beta OS=Drosophila melanogaster OX=7227 GN=AP-1-2beta PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	3.5e-174	591.9	Adaptin N terminal region
2	PF14796 AP3B1_C	8.3e-47	170.6	Clathrin-adaptor complex-3 beta-1 subunit C-terminal
3	PF12717 Cnd1	6.7e-18	76.7	non-SMC mitotic condensation complex subunit 1
4	PF02985 HEAT	0.016	26.4	HEAT repeat
5	PF13646 HEAT_2	0.011	27.4	HEAT repeats
6	PF13513 HEAT_EZ	85	15.1	HEAT-like repeat
7	PF20168 PDS5	57	12.9	Sister chromatid cohesion protein PDS5 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006643

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000016485	0.988	Adaptor-related protein complex 3, sigma 1 subunit
2	9593.ENSGGOP00000010841	0.972	Adaptor-related protein complex 3, mu 1 subunit
3	9593.ENSGGOP00000006444	0.949	AP-3 complex subunit delta
4	9593.ENSGGOP00000000471	0.883	Uncharacterized protein
5	9593.ENSGGOP00000010983	0.883	ADP-ribosylation factor 1
6	9593.ENSGGOP00000026915	0.877	Uncharacterized protein
7	9593.ENSGGOP00000000730	0.868	Cyclin G associated kinase
8	9593.ENSGGOP00000002040	0.833	Adaptor-related protein complex 3, mu 2 subunit
9	9593.ENSGGOP00000001786	0.813	SNARE-associated protein Snapin
10	9593.ENSGGOP00000020087	0.811	Coatomer subunit alpha
11	9593.ENSGGOP00000005665	0.809	Coatomer subunit beta'
12	9593.ENSGGOP00000011323	0.807	Adaptor-related protein complex 4, epsilon 1 subunit
13	9593.ENSGGOP00000001748	0.804	Adaptor-related protein complex 3, beta 1 subunit
14	9593.ENSGGOP00000004709	0.791	Adaptor-related protein complex 1, gamma 1 subunit
15	9593.ENSGGOP00000006032	0.783	Archain 1
16	9593.ENSGGOP00000005434	0.764	Dystrobrevin binding protein 1
17	9593.ENSGGOP00000002703	0.758	Adaptor-related protein complex 4, mu 1 subunit
18	9593.ENSGGOP00000027258	0.754	Adaptor-related protein complex 2, mu 1 subunit
19	9593.ENSGGOP00000004529	0.738	Adaptor-related protein complex 1, mu 2 subunit
20	9593.ENSGGOP00000028533	0.738	Adaptor-related protein complex 1, mu 1 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0030276	0.633	clathrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051234	0.985	establishment of localization
GO:0006810	0.984	transport
GO:0051641	0.975	cellular localization
GO:0046907	0.974	intracellular transport
GO:0006886	0.939	intracellular protein transport
GO:0016192	0.889	vesicle-mediated transport
GO:0010970	0.636	transport along microtubule
GO:0065007	0.552	biological regulation
GO:0008088	0.539	axo-dendritic transport
GO:0051650	0.517	establishment of vesicle localization
GO:0050789	0.511	regulation of biological process
GO:0072384	0.508	organelle transport along microtubule
GO:0098930	0.500	axonal transport
GO:0048489	0.492	synaptic vesicle transport
GO:0071840	0.484	cellular component organization or biogenesis
GO:0016043	0.461	cellular component organization
GO:0008089	0.339	anterograde axonal transport
GO:0099518	0.335	vesicle cytoskeletal trafficking
GO:0050794	0.327	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0016020	0.986	membrane
GO:0005794	0.982	Golgi apparatus
GO:0031984	0.943	organelle subcompartment
GO:0031410	0.936	cytoplasmic vesicle
GO:0005829	0.869	cytosol
GO:0031090	0.829	organelle membrane
GO:0098791	0.770	Golgi apparatus subcompartment
GO:0005802	0.754	trans-Golgi network
GO:0098588	0.654	bounding membrane of organelle
GO:0005768	0.398	endosome
GO:0005764	0.362	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]