StarFunc result for job id Q13370

User Input

>input (1112 residues)
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13370	1.000	1.000	0.000	1112	1.000	1.000	Q13370.pdb.gz	PDE3B_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Homo sapiens OX=9606 GN=PDE3B PE=1 SV=2
2	AFDB:Q14432	0.451	0.441	3.094E-65	1141	0.426	0.415	Q14432.pdb.gz	PDE3A_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3
3	AFDB:Q62865	0.367	0.358	7.711E-62	1141	0.437	0.426	Q62865.pdb.gz	PDE3A_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Rattus norvegicus OX=10116 GN=Pde3a PE=1 SV=1
4	PDB:4y86B	0.246	0.811	1.835E-16	326	0.076	0.261	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
5	PDB:6mzbB	0.265	0.362	5.430E-12	807	0.077	0.107	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
6	PDB:7jsnA	0.254	0.342	2.044E-11	820	0.072	0.098	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
7	PDB:3bjcA	0.222	0.751	5.873E-10	311	0.063	0.225	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
8	AFDB:Q6P3W6	0.035	0.042	4.600E-2	841	0.082	0.108	Q6P3W6.pdb.gz	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
9	AFDB:Q550K8	0.085	0.052	1.328E-1	2454	0.108	0.049	Q550K8.pdb.gz	Y7071_DICDI Probable serine/threonine-protein kinase DDB_G0277071 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277071 PE=3 SV=1
10	AFDB:Q6ZNL6	0.061	0.051	1.657E-1	1462	0.076	0.058	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
11	AFDB:O01667	0.035	0.053	2.942E-1	641	0.083	0.144	O01667.pdb.gz	O01667_DROME Homeoprotein Sail OS=Drosophila melanogaster OX=7227 GN=mirr PE=2 SV=1
12	AFDB:Q05812	0.042	0.057	2.942E-1	728	0.049	0.076	Q05812.pdb.gz	MSC3_YEAST Meiotic sister-chromatid recombination protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSC3 PE=1 SV=1
13	AFDB:Q86CZ2	0.071	0.067	2.942E-1	1213	0.079	0.073	Q86CZ2.pdb.gz	DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum OX=44689 GN=dhkK PE=1 SV=1
14	AFDB:Q8IX21	0.067	0.065	3.075E-1	1173	0.116	0.110	Q8IX21.pdb.gz	SLF2_HUMAN SMC5-SMC6 complex localization factor protein 2 OS=Homo sapiens OX=9606 GN=SLF2 PE=1 SV=2
15	PDB:7stmA	0.051	0.066	9.547E-1	801	0.041	0.057	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.
16	PDB:7xk7D	0.088	0.365	9.979E-1	206	0.020	0.107	7xk7D.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
17	PDB:5oxpA	0.054	0.091	2.415	462	0.031	0.074	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
18	PDB:3aqbD	0.079	0.181	2.524	325	0.034	0.117	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
19	PDB:6pojA	0.045	0.119	3.148	292	0.033	0.127	6pojA.pdb.gz
20	PDB:6zu0C	0.066	0.117	3.594	426	0.036	0.094	6zu0C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13370	0.0	2295	1112	1.000	1.000	PDE3B_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Homo sapiens OX=9606 GN=PDE3B PE=1 SV=2
2	Q14432	0.0	731	1141	0.434	0.423	PDE3A_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3
3	Q61409	0.0	1607	1100	0.783	0.792	PDE3B_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Mus musculus OX=10090 GN=Pde3b PE=1 SV=2
4	Q62865	0.0	700	1141	0.371	0.361	PDE3A_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Rattus norvegicus OX=10116 GN=Pde3a PE=1 SV=1
5	Q63085	0.0	1580	1108	0.792	0.795	PDE3B_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Rattus norvegicus OX=10116 GN=Pde3b PE=1 SV=1
6	Q9Z0X4	0.0	711	1141	0.375	0.365	PDE3A_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Mus musculus OX=10090 GN=Pde3a PE=1 SV=1
7	Q8I0P7	3.99e-95	320	678	0.146	0.239	PDE3_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-3 OS=Caenorhabditis elegans OX=6239 GN=pde-3 PE=3 SV=4
8	A0A0G2JZX9	2.38e-49	184	465	0.106	0.254	A0A0G2JZX9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
9	Q9EPR9	2.74e-49	186	542	0.106	0.218	Q9EPR9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=2 SV=1
10	A0A8I6GJQ6	2.90e-49	185	508	0.106	0.232	A0A8I6GJQ6_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
11	Q01063	4.69e-49	189	747	0.099	0.147	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2
12	P54750	5.20e-49	185	535	0.104	0.217	PDE1A_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2
13	A0A1B0GW84	5.28e-49	188	699	0.099	0.157	A0A1B0GW84_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=1
14	A0A8I5Y879	6.51e-49	184	508	0.106	0.232	A0A8I5Y879_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
15	A0A0G2K2K1	7.19e-49	184	515	0.106	0.229	A0A0G2K2K1_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
16	A0A8I6A416	8.21e-49	185	542	0.106	0.218	A0A8I6A416_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
17	A0A1U7QDZ1	8.84e-49	189	804	0.102	0.141	A0A1U7QDZ1_MESAU Phosphodiesterase OS=Mesocricetus auratus OX=10036 GN=Pde4d PE=3 SV=1
18	A0A140VJR0	9.84e-49	189	809	0.102	0.140	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
19	A0A8I6A5M3	9.84e-49	184	526	0.106	0.224	A0A8I6A5M3_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
20	Q08499	9.84e-49	189	809	0.102	0.140	PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06570 DUF1129	3.9e+02	12.0	Protein of unknown function (DUF1129)
2	PF00233 PDEase_I	1e-58	210.4	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282096

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352121	0.998	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
2	9606.ENSP00000480157	0.978	Phosphoinositide 3-kinase regulatory subunit 6
3	9606.ENSP00000395708	0.925	Rap guanine nucleotide exchange factor 3
4	9606.ENSP00000375892	0.922	RAC-beta serine/threonine-protein kinase
5	9606.ENSP00000451828	0.910	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000351957	0.908	cGMP-inhibited 3',5'-cyclic phosphodiesterase A
7	9606.ENSP00000286648	0.903	Deoxycytidine kinase
8	9606.ENSP00000286621	0.902	Adenosine kinase
9	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
10	9606.ENSP00000371230	0.900	GTP:AMP phosphotransferase AK3, mitochondrial
11	9606.ENSP00000485525	0.900	Adenylosuccinate lyase
12	9606.ENSP00000263826	0.818	RAC-gamma serine/threonine-protein kinase
13	9606.ENSP00000294016	0.777	Adenylate cyclase type 9
14	9606.ENSP00000312185	0.766	Engulfment and cell motility protein 1
15	9606.ENSP00000361930	0.761	14-3-3 protein beta/alpha
16	9606.ENSP00000387123	0.757	Alpha-aminoadipic semialdehyde dehydrogenase
17	9606.ENSP00000378187	0.743	Adenylate cyclase type 7
18	9606.ENSP00000419361	0.740	Adenylate cyclase type 5
19	9606.ENSP00000311405	0.735	Adenylate cyclase type 6
20	9606.ENSP00000003084	0.734	Cystic fibrosis transmembrane conductance regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0004119	0.584	cGMP-inhibited cyclic-nucleotide phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.982	response to stimulus
GO:0051716	0.900	cellular response to stimulus
GO:0023051	0.894	regulation of signaling
GO:0048583	0.887	regulation of response to stimulus
GO:0010646	0.879	regulation of cell communication
GO:0032501	0.866	multicellular organismal process
GO:0090087	0.861	regulation of peptide transport
GO:0065008	0.842	regulation of biological quality
GO:0043949	0.837	regulation of cAMP-mediated signaling
GO:0048519	0.831	negative regulation of biological process
GO:0010817	0.818	regulation of hormone levels
GO:0048523	0.811	negative regulation of cellular process
GO:0008152	0.788	metabolic process
GO:0032502	0.785	developmental process
GO:0019222	0.780	regulation of metabolic process
GO:0007165	0.731	signal transduction
GO:0042221	0.715	response to chemical
GO:0002791	0.715	regulation of peptide secretion
GO:0023057	0.707	negative regulation of signaling
GO:0010648	0.702	negative regulation of cell communication
GO:0050708	0.696	regulation of protein secretion
GO:0046883	0.695	regulation of hormone secretion
GO:0050796	0.694	regulation of insulin secretion
GO:0048585	0.687	negative regulation of response to stimulus
GO:0010033	0.671	response to organic substance
GO:0044238	0.617	primary metabolic process
GO:0071704	0.600	organic substance metabolic process
GO:0009968	0.461	negative regulation of signal transduction
GO:1902532	0.434	negative regulation of intracellular signal transduction
GO:0048856	0.368	anatomical structure development
GO:0044237	0.364	cellular metabolic process
GO:0080090	0.328	regulation of primary metabolic process
GO:0051239	0.310	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0032991	0.901	protein-containing complex
GO:0043231	0.813	intracellular membrane-bounded organelle
GO:0140535	0.654	intracellular protein-containing complex
GO:0032045	0.386	guanyl-nucleotide exchange factor complex
GO:0012505	0.344	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.

[back to server]