StarFunc result for job id Q13387

User Input

>input (824 residues)
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPA
PGPLIPSPSVEEPHKHRPTTLRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALR
ELPGPLPATDTGPGGAQSPVRPGCDCEGNRPAEPPAPGGTSPSSDPGIEADLRSRSSGGR
GGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSGRSSHLTNSIEEA
SSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMIS
EGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEE
DAEDSAGSPGGRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDS
GGEASEEEAGAALLGGGQVSGDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLV
NGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYA
HAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLR
PPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLS
RFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13387	0.999	0.999	0.000	824	1.000	1.000	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
2	AFDB:G3V9M2	0.291	0.287	1.205E-85	835	0.877	0.866	G3V9M2.pdb.gz	JIP2_RAT C-Jun-amino-terminal kinase-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Mapk8ip2 PE=1 SV=1
3	AFDB:Q63HR2	0.142	0.089	1.451E-6	1409	0.184	0.108	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
4	AFDB:Q9HBL0	0.142	0.072	1.624E-6	1735	0.170	0.081	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
5	AFDB:Q5SSZ5	0.132	0.080	3.769E-6	1440	0.205	0.117	Q5SSZ5.pdb.gz	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
6	AFDB:Q9W2S5	0.142	0.058	4.217E-6	2139	0.170	0.065	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
7	AFDB:Q68CZ2	0.129	0.081	5.584E-6	1445	0.182	0.104	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
8	PDB:2h8hA	0.068	0.123	7.033E-4	445	0.024	0.045	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
9	PDB:3ehqA	0.069	0.296	8.323E-4	182	0.023	0.104	3ehqA.pdb.gz
10	PDB:6x5hA	0.073	0.126	8.323E-4	467	0.017	0.030	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
11	PDB:5yqrA	0.093	0.268	1.166E-3	268	0.016	0.049	5yqrA.pdb.gz
12	AFDB:A0A0U1RQE4	0.083	0.071	1.621E-3	1047	0.169	0.133	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
13	PDB:2dybA	0.068	0.181	1.727E-3	298	0.018	0.050	2dybA.pdb.gz
14	AFDB:O35413	0.076	0.054	1.919E-3	1196	0.137	0.094	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
15	PDB:3cm1A	0.091	0.371	2.419E-3	137	0.019	0.117	3cm1A.pdb.gz
16	PDB:3qwyA	0.067	0.313	3.388E-3	170	0.012	0.059	3qwyA.pdb.gz
17	PDB:7r04B	0.089	0.034	3.790E-3	2229	0.012	0.004	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
18	PDB:7mp5A	0.096	0.050	4.745E-3	1629	0.013	0.007	7mp5A.pdb.gz
19	PDB:7pgrN	0.091	0.033	5.019E-3	2423	0.013	0.005	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
20	AFDB:A0A494C1M0	0.072	0.060	6.980E-3	1011	0.135	0.110	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V9M2	0.0	1180	835	0.860	0.849	JIP2_RAT C-Jun-amino-terminal kinase-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Mapk8ip2 PE=1 SV=1
2	Q13387	0.0	1643	824	1.000	1.000	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
3	Q9ERE9	0.0	1202	830	0.876	0.870	JIP2_MOUSE C-Jun-amino-terminal kinase-interacting protein 2 OS=Mus musculus OX=10090 GN=Mapk8ip2 PE=1 SV=1
4	E9PBB9	2.45e-130	407	701	0.244	0.287	E9PBB9_HUMAN Mitogen-activated protein kinase 8 interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
5	Q9UQF2	4.09e-130	407	711	0.244	0.283	JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=MAPK8IP1 PE=1 SV=1
6	Q9R237	8.44e-130	406	708	0.244	0.284	JIP1_RAT C-Jun-amino-terminal kinase-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mapk8ip1 PE=1 SV=2
7	Q9WVI9	1.35e-129	405	707	0.244	0.284	JIP1_MOUSE C-Jun-amino-terminal kinase-interacting protein 1 OS=Mus musculus OX=10090 GN=Mapk8ip1 PE=1 SV=2
8	Q9W0K0	3.36e-51	189	490	0.115	0.194	JIP1_DROME JNK-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Aplip1 PE=1 SV=2
9	Q9UBP9	4.41e-08	58.2	304	0.046	0.125	GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens OX=9606 GN=GULP1 PE=1 SV=1
10	G5EC32	8.14e-06	52.0	1005	0.027	0.022	SRBS1_CAEEL Sorbin and SH3 domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=sorb-1 PE=1 SV=1
11	P59672	4.80e-05	49.7	1150	0.041	0.030	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
12	Q7Z6J0	4.88e-05	49.7	888	0.028	0.026	SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens OX=9606 GN=SH3RF1 PE=1 SV=2
13	Q92625	5.39e-05	49.3	1134	0.041	0.030	ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4
14	Q6NRD3	6.78e-05	48.9	826	0.029	0.029	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
15	A0A3B3ISP1	7.02e-05	48.9	1194	0.041	0.028	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
16	Q69ZI1	9.49e-05	48.5	892	0.027	0.025	SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus OX=10090 GN=Sh3rf1 PE=1 SV=2
17	Q71F54	1.35e-04	48.1	894	0.027	0.025	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
18	Q49AR9	1.85e-04	47.4	570	0.041	0.060	Q49AR9_HUMAN ANKS1A protein OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
19	Q9R1Z8	3.34e-04	46.6	733	0.030	0.034	VINEX_MOUSE Vinexin OS=Mus musculus OX=10090 GN=Sorbs3 PE=1 SV=1
20	Q8TEJ3	4.35e-04	46.6	882	0.025	0.024	SH3R3_HUMAN E3 ubiquitin-protein ligase SH3RF3 OS=Homo sapiens OX=9606 GN=SH3RF3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	3.5e-29	113.1	Phosphotyrosine interaction domain (PTB/PID)
2	PF00018 SH3_1	0.018	26.0	SH3 domain
3	PF07653 SH3_2	6.2e+02	11.6	Variant SH3 domain
4	PF14604 SH3_9	1.4e-08	45.9	Variant SH3 domain
5	PF05642 Sporozoite_P67	8e+02	9.5	Sporozoite P67 surface antigen

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330572

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241014	0.974	C-Jun-amino-terminal kinase-interacting protein 1
2	9606.ENSP00000381070	0.958	Dual specificity mitogen-activated protein kinase kinase 7
3	9606.ENSP00000309597	0.953	Mitogen-activated protein kinase kinase kinase 11
4	9606.ENSP00000250894	0.941	C-Jun-amino-terminal kinase-interacting protein 3
5	9606.ENSP00000352157	0.927	Mitogen-activated protein kinase 10
6	9606.ENSP00000378974	0.923	Mitogen-activated protein kinase 8
7	9606.ENSP00000394560	0.917	Mitogen-activated protein kinase 9
8	9606.ENSP00000413496	0.913	Fibroblast growth factor 12
9	9606.ENSP00000303634	0.902	Low-density lipoprotein receptor-related protein 8
10	9606.ENSP00000345083	0.885	Dual specificity mitogen-activated protein kinase kinase 3
11	9606.ENSP00000284981	0.876	Amyloid-beta A4 protein
12	9606.ENSP00000253055	0.832	Mitogen-activated protein kinase kinase kinase 10
13	9606.ENSP00000465039	0.814	Mitogen-activated protein kinase kinase kinase kinase 1
14	9606.ENSP00000286827	0.788	T-lymphoma invasion and metastasis-inducing protein 1
15	9606.ENSP00000478767	0.780	Neurabin-2
16	9606.ENSP00000265026	0.777	Mitogen-activated protein kinase kinase kinase 13
17	9606.ENSP00000216075	0.754	Belongs to the myo-inositol oxygenase family.
18	9606.ENSP00000379087	0.733	ADM2
19	9606.ENSP00000262013	0.732	C-Jun-amino-terminal kinase-interacting protein 4
20	9606.ENSP00000211287	0.727	Mitogen-activated protein kinase 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	0.997	kinase binding
GO:0035591	0.996	signaling adaptor activity
GO:0019901	0.994	protein kinase binding
GO:0005078	0.987	MAP-kinase scaffold activity
GO:0098772	0.956	molecular function regulator activity
GO:0019207	0.937	kinase regulator activity
GO:0019887	0.931	protein kinase regulator activity
GO:0140677	0.897	molecular function activator activity
GO:0030295	0.871	protein kinase activator activity
GO:0005198	0.845	structural molecule activity
GO:0008092	0.536	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.982	response to stimulus
GO:0007165	0.971	signal transduction
GO:0048583	0.953	regulation of response to stimulus
GO:0010646	0.937	regulation of cell communication
GO:0009966	0.926	regulation of signal transduction
GO:1902531	0.823	regulation of intracellular signal transduction
GO:0048523	0.787	negative regulation of cellular process
GO:0032872	0.755	regulation of stress-activated MAPK cascade
GO:0035556	0.737	intracellular signal transduction
GO:0000165	0.486	MAPK cascade
GO:0048518	0.449	positive regulation of biological process
GO:0048522	0.408	positive regulation of cellular process
GO:0010941	0.407	regulation of cell death
GO:0071840	0.402	cellular component organization or biogenesis
GO:0016043	0.371	cellular component organization
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.931	protein-containing complex
GO:0005829	0.927	cytosol
GO:0043226	0.916	organelle
GO:0016020	0.834	membrane
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0071944	0.472	cell periphery
GO:0005886	0.460	plasma membrane
GO:0070013	0.306	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]