StarFunc result for job id Q13393

User Input

>input (1074 residues)
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPVQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHDADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFARGLRLQCF
RVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14939	0.791	0.907	0.000	933	0.495	0.570	O14939.pdb.gz	PLD2_HUMAN Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2
2	AFDB:P70496	0.969	0.969	0.000	1074	0.906	0.906	P70496.pdb.gz	PLD1_RAT Phospholipase D1 OS=Rattus norvegicus OX=10116 GN=Pld1 PE=1 SV=3
3	AFDB:P70498	0.808	0.927	0.000	933	0.492	0.566	P70498.pdb.gz	PLD2_RAT Phospholipase D2 OS=Rattus norvegicus OX=10116 GN=Pld2 PE=1 SV=2
4	AFDB:Q59EA4	0.865	0.877	0.000	1059	0.963	0.976	Q59EA4.pdb.gz	Q59EA4_HUMAN phospholipase D (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:Q09706	0.688	0.545	3.478E-70	1369	0.312	0.245	Q09706.pdb.gz	PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pld1 PE=1 SV=1
6	AFDB:A0A1D8PF62	0.599	0.385	7.786E-67	1710	0.286	0.180	A0A1D8PF62.pdb.gz	A0A1D8PF62_CANAL Phospholipase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PLD1 PE=3 SV=1
7	AFDB:P36126	0.586	0.381	1.204E-63	1683	0.272	0.173	P36126.pdb.gz	SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPO14 PE=1 SV=3
8	AFDB:C8V1Q0	0.508	0.651	7.230E-56	833	0.224	0.289	C8V1Q0.pdb.gz	C8V1Q0_EMENI Phospholipase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06712 PE=3 SV=1
9	AFDB:Q54WR4	0.564	0.500	1.913E-54	1216	0.225	0.199	Q54WR4.pdb.gz	PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum OX=44689 GN=pldB PE=2 SV=1
10	PDB:7wdkA	0.421	0.514	8.515E-35	867	0.169	0.210	7wdkA.pdb.gz
11	PDB:7v53A	0.441	0.505	2.870E-34	930	0.173	0.200	7v53A.pdb.gz
12	PDB:7v55A	0.434	0.587	3.941E-34	781	0.164	0.225	7v55A.pdb.gz	Structural insights into PA3488-mediated inactivation of Pseudomonas aeruginosa PldA.
13	AFDB:Q9HYC2	0.425	0.416	4.051E-32	1099	0.180	0.176	Q9HYC2.pdb.gz	Q9HYC2_PSEAE Phospholipase D OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pldA PE=1 SV=1
14	PDB:6kz8A	0.395	0.530	1.034E-30	784	0.162	0.222	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
15	PDB:1q32B	0.210	0.455	9.238E-5	420	0.046	0.117	1q32B.pdb.gz
16	PDB:3ljuX	0.083	0.220	3.847E-4	373	0.028	0.080	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6bbpA	0.091	0.167	5.870E-4	520	0.039	0.081	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:1xdpA	0.201	0.301	8.060E-4	687	0.047	0.074	1xdpA.pdb.gz	Crystal structure of a polyphosphate kinase and its implications for polyphosphate synthesis
19	PDB:2dybA	0.092	0.299	1.689E-3	298	0.034	0.121	2dybA.pdb.gz
20	PDB:4gouA	0.092	0.164	2.864E-3	507	0.021	0.045	4gouA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0V1J1	0.0	1475	1022	0.674	0.708	B0V1J1_DANRE Phospholipase OS=Danio rerio OX=7955 GN=pld1 PE=3 SV=1
2	P70496	0.0	2046	1074	0.907	0.907	PLD1_RAT Phospholipase D1 OS=Rattus norvegicus OX=10116 GN=Pld1 PE=1 SV=3
3	P97813	0.0	555	933	0.247	0.284	PLD2_MOUSE Phospholipase D2 OS=Mus musculus OX=10090 GN=Pld2 PE=1 SV=2
4	Q13393	0.0	2243	1074	1.000	1.000	PLD1_HUMAN Phospholipase D1 OS=Homo sapiens OX=9606 GN=PLD1 PE=1 SV=1
5	Q59EA4	0.0	2142	1059	0.964	0.977	Q59EA4_HUMAN phospholipase D (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	Q9Z280	0.0	2045	1074	0.911	0.911	PLD1_MOUSE Phospholipase D1 OS=Mus musculus OX=10090 GN=Pld1 PE=1 SV=1
7	O14939	1.92e-179	550	933	0.249	0.286	PLD2_HUMAN Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2
8	P70498	2.09e-179	550	933	0.245	0.282	PLD2_RAT Phospholipase D2 OS=Rattus norvegicus OX=10116 GN=Pld2 PE=1 SV=2
9	Q9BP34	4.60e-124	412	1278	0.199	0.167	Q9BP34_DROME Phospholipase OS=Drosophila melanogaster OX=7227 GN=Pld PE=3 SV=1
10	Q9BP35	4.33e-123	410	1278	0.198	0.167	Q9BP35_DROME Phospholipase OS=Drosophila melanogaster OX=7227 GN=Pld PE=2 SV=1
11	A4UZ54	4.58e-123	409	1260	0.198	0.169	A4UZ54_DROME Phospholipase OS=Drosophila melanogaster OX=7227 GN=Pld PE=3 SV=1
12	Q7KML4	4.65e-123	409	1278	0.198	0.167	Q7KML4_DROME Phospholipase OS=Drosophila melanogaster OX=7227 GN=Pld PE=2 SV=1
13	B7YZT5	1.69e-122	409	1364	0.198	0.156	B7YZT5_DROME Phospholipase OS=Drosophila melanogaster OX=7227 GN=Pld PE=3 SV=1
14	Q6NR18	7.02e-98	328	739	0.146	0.212	Q6NR18_DROME phospholipase D OS=Drosophila melanogaster OX=7227 GN=Pld PE=2 SV=1
15	Q09706	1.58e-84	302	1369	0.163	0.128	PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pld1 PE=1 SV=1
16	A0A1D8PF62	2.09e-82	297	1710	0.149	0.094	A0A1D8PF62_CANAL Phospholipase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PLD1 PE=3 SV=1
17	P36126	4.30e-79	286	1683	0.139	0.089	SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPO14 PE=1 SV=3
18	Q9M9W8	5.24e-78	279	1046	0.139	0.142	PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana OX=3702 GN=PLPZETA2 PE=1 SV=2
19	Q9LRZ5	1.11e-77	279	1096	0.144	0.141	PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana OX=3702 GN=PLDZETA1 PE=1 SV=1
20	Q54WR4	5.57e-51	198	1216	0.115	0.102	PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum OX=44689 GN=pldB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12653 DUF3785	2.2e+02	13.4	Protein of unknown function (DUF3785)
2	PF00169 PH	8.7e-05	34.3	PH domain
3	PF00614 PLDc	1.2e-11	55.5	Phospholipase D Active site motif
4	PF13091 PLDc_2	1.6e-11	55.7	PLD-like domain
5	PF00787 PX	6.3e-12	57.4	PX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000005257	0.994	Ras-related protein Ral-A
3	9606.ENSP00000357055	0.992	Astrocytic phosphoprotein PEA-15
4	9606.ENSP00000408695	0.991	Protein kinase C alpha type
5	9606.ENSP00000298316	0.986	ADP-ribosylation factor 6
6	9606.ENSP00000440005	0.978	ADP-ribosylation factor 1
7	9606.ENSP00000383118	0.964	Cell division control protein 42 homolog
8	9606.ENSP00000371586	0.954	Phosphatidylserine decarboxylase proenzyme, mitochondrial
9	9606.ENSP00000348461	0.952	Ras-related C3 botulinum toxin substrate 1
10	9606.ENSP00000268099	0.950	Secretory carrier-associated membrane protein 2
11	9606.ENSP00000255389	0.948	Phosphatidylethanolamine N-methyltransferase
12	9606.ENSP00000262187	0.941	GTP-binding protein Rheb
13	9606.ENSP00000295887	0.937	Phosphatidate cytidylyltransferase 1
14	9606.ENSP00000229266	0.934	Cholinephosphotransferase 1
15	9606.ENSP00000338345	0.933	Alpha-synuclein
16	9606.ENSP00000308258	0.932	Phosphatidylserine synthase 2
17	9606.ENSP00000419879	0.930	Phosphatidate cytidylyltransferase 2
18	9606.ENSP00000441980	0.928	Choline/ethanolaminephosphotransferase 1
19	9606.ENSP00000264005	0.916	Phosphatidylcholine-sterol acyltransferase
20	9606.ENSP00000272519	0.916	Ras-related protein Ral-B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004630	1.000	phospholipase D activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.992	cellular metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0046473	0.958	phosphatidic acid metabolic process
GO:0050896	0.954	response to stimulus
GO:0008654	0.926	phospholipid biosynthetic process
GO:0046474	0.916	glycerophospholipid biosynthetic process
GO:0048518	0.906	positive regulation of biological process
GO:0048522	0.877	positive regulation of cellular process
GO:0006654	0.771	phosphatidic acid biosynthetic process
GO:0009605	0.730	response to external stimulus
GO:0042221	0.714	response to chemical
GO:0019222	0.474	regulation of metabolic process
GO:0051716	0.460	cellular response to stimulus
GO:0007154	0.436	cell communication
GO:0023052	0.409	signaling
GO:0006807	0.338	nitrogen compound metabolic process
GO:0060255	0.312	regulation of macromolecule metabolic process
GO:0007165	0.312	signal transduction
GO:0006950	0.306	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0016020	0.996	membrane
GO:0031090	0.974	organelle membrane
GO:0005783	0.897	endoplasmic reticulum
GO:0005789	0.850	endoplasmic reticulum membrane
GO:0031982	0.849	vesicle
GO:0098588	0.734	bounding membrane of organelle
GO:0097708	0.694	intracellular vesicle
GO:0031410	0.670	cytoplasmic vesicle
GO:0000323	0.575	lytic vacuole
GO:0005886	0.569	plasma membrane
GO:0005764	0.559	lysosome
GO:0005794	0.491	Golgi apparatus
GO:0030054	0.469	cell junction
GO:0070013	0.420	intracellular organelle lumen
GO:0005829	0.335	cytosol
GO:0005774	0.327	vacuolar membrane
GO:0098852	0.314	lytic vacuole membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14445	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + choline + H(+)
EC:3.1.4.4	1.000	phospholipase D.

[back to server]