StarFunc result for job id Q13395

User Input

>input (1621 residues)
MEWVLAEALLSQSRDPRALLGALCQGEASAERVETLRFLLQRLEDEEARGSGGAGALPEA
AREVAAGYLVPLLRSLRGRPAGGPDPSLQPRHRRRVLRAAGAALRSCVRLAGRPQLAAAL
AEEALRDLLAGWRAPGAEAAVEVLAAVGPCLRPREDGPLLERVAGTAVALALGGGGDGDE
AGPAEDAAALVAGRLLPVLVQCGGAALRAVWGGLAAPGASLGSGRVEEKLLVLSALAEKL
LPEPGGDRARGAREAGPDARRCWRFWRTVQAGLGQADALTRKRARYLLQRAVEVSAELGA
DCTCGPQEGNGPSLFWWSERKKDELLKFWENYILIMETLEGNQIHVIKPVLPKLNNLFEY
AVSEENGCWLFHPSWHMCIYKRMFESENKILSKEGVIHFLELYETKILPFSPEFSEFIIG
PLMDALSESSLYSRSPGQPIGSCSPLGLKLQKFLVTYISLLPEEIKSSFLLKFIRKMTSR
HWCAVPILFLSKALANVPRHKALGIDGLLALRDVIHCTMITHQILLRGAAQCYLLQTAMN
LLDVEKVSLSDVSTFLMSLRQEESLGRGTSLWTELCDWLRVNESYFKPSPTCSSIGLHKT
SLNAYVKSIVQEYVKSSAWETGENCFMPDWFEAKLVSLMVLLAVDVEGMKTQYSGKQRTE
NVLRIFLDPLLDVLMKFSTNAYMPLLKTDRCLQLLLKLLNTCRLKGSSAQDDEVSTVLQN
FFMSTTESISEFILRRLTMNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVI
SLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAGPLES
FLSSLQLNQTLQKPHAEEQSSYAHPLECSSVLEESSSSQGWGKIVAQYIHDQWVCLSFLL
KKYHTLIPTTGSEILEPFLPAVQMPIRTLQSALEALTVLSSDQVLPVFHCLKVLVPKLLT
SSESLCIESFDMAWKIISSLSNTQLIFWANLKAFVQFVFDNKVLTIAAKIKGQAYFKIKE
IMYKIIEMSAIKTGVFNTLISYCCQSWIVSASNVSQGSLSSAKNYSELILEACIFGTVFR
RDQRLVQDVQTFIENLGHDCAANIVMENTKREDHYVRICAVKFLCLLDGSNMSHKLFIED
LAIKLLDKDELVSKSKKRYYVNSLQHRVKNRVWQTLLVLFPRLDQNFLNGIIDRIFQAGF
TNNQASIKYFIEWIIILILHKFPQFLPKFWDCFSYGEENLKTSICTFLAVLSHLDIITQN
IPEKKLILKQALIVVLQWCFNHNFSVRLYALVALKKLWTVCKVLSVEEFDALTPVIESSL
HQVESMHGAGNAKKNWQRIQEHFFFATFHPLKDYCLETIFYILPRLSGLIEDEWITIDKF
TRFTDVPLAAGFQWYLSQTQLSKLKPGDWSQQDIGTNLVEADNQAEWTDVQKKIIPWNSR
VSDLDLELLFQDRAARLGKSISRLIVVASLIDKPTNLGGLCRTCEVFGASVLVVGSLQCI
SDKQFQHLSVSAEQWLPLVEVKPPQLIDYLQQKKTEGYTIIGVEQTAKSLDLTQYCFPEK
SLLLLGNEREGIPANLIQQLDVCVEIPQQGIIRSLNVHVSGALLIWEYTRQQLLSHGDTK
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13395	1.000	1.000	0.000	1621	1.000	1.000	Q13395.pdb.gz	TARB1_HUMAN Probable methyltransferase TARBP1 OS=Homo sapiens OX=9606 GN=TARBP1 PE=1 SV=1
2	AFDB:Q381K3	0.539	0.513	2.970E-29	1716	0.189	0.179	Q381K3.pdb.gz	Q381K3_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7490 PE=4 SV=1
3	AFDB:Q07527	0.566	0.630	1.066E-26	1436	0.163	0.184	Q07527.pdb.gz	TRM3_YEAST tRNA (guanosine(18)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM3 PE=1 SV=1
4	AFDB:Q9VKY2	0.155	0.182	6.005E-8	1248	0.100	0.130	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
5	AFDB:A2AGT5	0.117	0.097	4.897E-7	2032	0.116	0.093	A2AGT5.pdb.gz	CKAP5_MOUSE Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1
6	AFDB:P0AGJ2	0.086	0.564	8.491E-7	229	0.021	0.148	P0AGJ2.pdb.gz	TRMH_ECOLI tRNA (guanosine(18)-2'-O)-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=trmH PE=1 SV=1
7	PDB:1x7oA	0.088	0.495	1.080E-6	267	0.024	0.146	1x7oA.pdb.gz
8	PDB:7edcA	0.096	0.585	1.118E-6	236	0.023	0.157	7edcA.pdb.gz	Unique substrate specificity of type II tRNA Gm18 methyltransferase from Escherichia coli
9	AFDB:P38737	0.136	0.123	1.118E-6	1868	0.109	0.095	P38737.pdb.gz	ECM29_YEAST Proteasome component ECM29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ECM29 PE=1 SV=1
10	AFDB:O67577	0.099	0.695	1.240E-6	211	0.026	0.199	O67577.pdb.gz	TRMH_AQUAE tRNA (guanosine(18)-2'-O)-methyltransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=trmH PE=1 SV=1
11	PDB:1zjrA	0.099	0.732	1.374E-6	197	0.025	0.208	1zjrA.pdb.gz
12	AFDB:Q5SM16	0.097	0.731	1.374E-6	194	0.026	0.216	Q5SM16.pdb.gz	TRMH_THET8 tRNA (guanosine(18)-2'-O)-methyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=trmH PE=1 SV=1
13	AFDB:F4HRS2	0.136	0.108	1.423E-6	2222	0.130	0.095	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
14	PDB:1gz0F	0.089	0.534	4.131E-6	253	0.022	0.142	1gz0F.pdb.gz
15	PDB:1v2xA	0.094	0.725	4.131E-6	191	0.024	0.204	1v2xA.pdb.gz	Deep Knot Structure for Construction of Active Site and Cofactor Binding Site of tRNA Modification Enzyme
16	PDB:4a0cA	0.156	0.193	4.580E-6	1155	0.101	0.142	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	PDB:7q2xD	0.119	0.164	5.440E-6	994	0.082	0.134	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
18	PDB:3w3zA	0.171	0.239	6.687E-6	1013	0.090	0.144	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
19	PDB:7ajuUT	0.142	0.113	7.942E-6	2313	0.115	0.080	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7qenD	0.113	0.154	9.762E-6	1050	0.080	0.123	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13395	0.0	3325	1621	1.000	1.000	TARB1_HUMAN Probable methyltransferase TARBP1 OS=Homo sapiens OX=9606 GN=TARBP1 PE=1 SV=1
2	Q07527	3.84e-38	159	1436	0.044	0.049	TRM3_YEAST tRNA (guanosine(18)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRM3 PE=1 SV=1
3	Q381K3	3.76e-35	149	1716	0.053	0.050	Q381K3_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7490 PE=4 SV=1
4	O67577	3.60e-11	66.6	211	0.025	0.190	TRMH_AQUAE tRNA (guanosine(18)-2'-O)-methyltransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=trmH PE=1 SV=1
5	Q5SM16	1.30e-09	61.6	194	0.025	0.206	TRMH_THET8 tRNA (guanosine(18)-2'-O)-methyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=trmH PE=1 SV=1
6	Q72GI1	1.30e-09	61.6	194	0.025	0.206	TRMH_THET2 tRNA (guanosine(18)-2'-O)-methyltransferase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=trmH PE=1 SV=1
7	P0AGJ5	4.80e-08	59.3	345	0.025	0.116	YFIF_ECOLI Uncharacterized tRNA/rRNA methyltransferase YfiF OS=Escherichia coli (strain K12) OX=83333 GN=yfiF PE=1 SV=1
8	P0AGJ2	2.49e-07	55.8	229	0.026	0.183	TRMH_ECOLI tRNA (guanosine(18)-2'-O)-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=trmH PE=1 SV=1
9	Q9F5K6	1.16e-06	54.7	287	0.028	0.157	AVRB_STRVR 23S rRNA (uridine(2479)-2'-O)-methyltransferase OS=Streptomyces viridochromogenes OX=1938 GN=aviRb PE=1 SV=1
10	P25270	1.45e-05	52.0	412	0.028	0.112	MRM1_YEAST rRNA methyltransferase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM1 PE=1 SV=2
11	P63177	0.002	44.3	243	0.023	0.152	RLMB_ECOLI 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Escherichia coli (strain K12) OX=83333 GN=rlmB PE=1 SV=1
12	P94978	0.26	37.7	260	0.021	0.131	P94978_MYCTU Possible 23S rRNA methyltransferase TsnR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsnR PE=1 SV=2
13	Q9EQH2	0.30	38.1	930	0.015	0.026	ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus OX=10090 GN=Erap1 PE=1 SV=2
14	Q8W497	0.49	37.4	589	0.023	0.063	Q8W497_ARATH rRNA methyltransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g19870 PE=1 SV=1
15	Q9YAZ5	1.1	36.2	356	0.019	0.084	PELO_AERPE Protein pelota homolog OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=pelA PE=1 SV=2
16	P44868	1.2	34.7	160	0.020	0.200	TRML_HAEIN tRNA (cytidine(34)-2'-O)-methyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=trmL PE=1 SV=1
17	Q9JJ22	1.2	36.2	930	0.017	0.029	ERAP1_RAT Endoplasmic reticulum aminopeptidase 1 OS=Rattus norvegicus OX=10116 GN=Erap1 PE=2 SV=2
18	Q00526	1.3	35.8	305	0.018	0.095	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
19	Q9WUF3	1.3	36.2	1962	0.011	0.009	C8AP2_MOUSE CASP8-associated protein 2 OS=Mus musculus OX=10090 GN=Casp8ap2 PE=1 SV=2
20	Q6NPL4	2.4	34.7	263	0.022	0.133	Q6NPL4_ARATH At5g26880 OS=Arabidopsis thaliana OX=3702 GN=AGL26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00588 SpoU_methylase	9.9e-28	108.5	SpoU rRNA Methylase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000040877

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000466967	0.879	tRNA (guanine(26)-N(2))-dimethyltransferase
2	9606.ENSP00000298746	0.828	Probable tRNA pseudouridine synthase 1
3	9606.ENSP00000264670	0.812	tRNA (cytosine(34)-C(5))-methyltransferase
4	9606.ENSP00000374387	0.794	Probable tRNA (uracil-O(2)-)-methyltransferase
5	9606.ENSP00000339063	0.792	Elongation factor 1-alpha 1
6	9606.ENSP00000273962	0.786	tRNA methyltransferase 10 homolog A
7	9606.ENSP00000261637	0.779	Small subunit processome component 20 homolog
8	9606.ENSP00000326948	0.778	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
9	9606.ENSP00000377958	0.776	T-complex protein 1 subunit delta
10	9606.ENSP00000463058	0.772	RNA-binding protein 8A
11	9606.ENSP00000261249	0.766	tRNA (guanine(37)-N1)-methyltransferase
12	9606.ENSP00000263857	0.766	DNA-directed RNA polymerase I subunit RPA1
13	9606.ENSP00000227474	0.744	tRNA pseudouridine(38/39) synthase
14	9606.ENSP00000314441	0.737	tRNA (guanine-N(7)-)-methyltransferase
15	9606.ENSP00000203001	0.725	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
16	9606.ENSP00000395835	0.714	Coiled-coil domain containing 129
17	9606.ENSP00000333934	0.678	tRNA (guanine(10)-N2)-methyltransferase homolog
18	9606.ENSP00000392985	0.662	Oxidoreductase HTATIP2
19	9606.ENSP00000315136	0.646	Amyloid-beta A4 precursor protein-binding family A member 3
20	9606.ENSP00000453293	0.644	Amyloid-beta A4 precursor protein-binding family A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.872	protein binding
GO:0003824	0.866	catalytic activity
GO:0016740	0.849	transferase activity
GO:0140640	0.526	catalytic activity, acting on a nucleic acid
GO:0140098	0.484	catalytic activity, acting on RNA
GO:0008168	0.476	methyltransferase activity
GO:0008173	0.467	RNA methyltransferase activity
GO:0008757	0.446	S-adenosylmethionine-dependent methyltransferase activity
GO:0140101	0.408	catalytic activity, acting on a tRNA
GO:0008175	0.355	tRNA methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0050789	0.972	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0010468	0.959	regulation of gene expression
GO:0010556	0.942	regulation of macromolecule biosynthetic process
GO:0031326	0.942	regulation of cellular biosynthetic process
GO:0051252	0.921	regulation of RNA metabolic process
GO:0006355	0.829	regulation of DNA-templated transcription
GO:0009987	0.718	cellular process
GO:0071704	0.708	organic substance metabolic process
GO:0006807	0.680	nitrogen compound metabolic process
GO:0044237	0.679	cellular metabolic process
GO:0044238	0.661	primary metabolic process
GO:0043170	0.654	macromolecule metabolic process
GO:0006357	0.646	regulation of transcription by RNA polymerase II
GO:0034641	0.607	cellular nitrogen compound metabolic process
GO:0090304	0.485	nucleic acid metabolic process
GO:0010467	0.455	gene expression
GO:0016070	0.450	RNA metabolic process
GO:0006396	0.432	RNA processing
GO:0043412	0.341	macromolecule modification
GO:0044260	0.340	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.973	intracellular organelle lumen
GO:0005737	0.962	cytoplasm
GO:0031981	0.901	nuclear lumen
GO:0005654	0.773	nucleoplasm
GO:0043232	0.771	intracellular non-membrane-bounded organelle
GO:0005829	0.600	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.849	Transferases.
EC:2.1.1.-	0.476	Methyltransferases.

[back to server]